DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Prss21

DIOPT Version :8

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus

Alignment Length:302 Identity:86/303 (28%)
Similarity:127/303 (42%) Gaps:65/303 (21%)


  Fly    24 KPMGNVIDLDK-YFEEADLNS--------QERVVGGYDVPEDEYVPYQVSMQFLTRSGKMR---- 75
            ||    :|.:| ..:||:|.|        ..|:|||.:.....: |:|         |.:|    
  Rat    30 KP----VDPEKPELQEANLLSGPCGHRTIPSRIVGGEEAELGRW-PWQ---------GSLRVWGN 80

  Fly    76 HFCGGSLIAPNRVLTAAHCVN------------GQNASRISVVAGIRDLNDSSGFRSQVQSYEMN 128
            |.||.:|:....|||||||..            |:..||.|    :.:|...|. |.|::...::
  Rat    81 HLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPS----LWNLQAYSN-RYQIEDIFLS 140

  Fly   129 ENYQELVTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQ-EVLLTGWGSVFHFGTGPFAKYP 192
            ..|.|....|||:||:..|... ...:..|.:..|....|:: :..:||||::   |.......|
  Rat   141 PKYTEQFPHDIALLKLSSPVTY-SNFIQPICLLNSTYKFANRTDCWVTGWGAI---GEDESLPLP 201

  Fly   193 TVLQKLDYKTLSNSKCKETMTQ------LTDTEICA-LERFGKGAC---------NGDSGGPLVM 241
            ..||::....::|:.|.....:      :....:|| ....||.||         .||||||||.
  Rat   202 NNLQEVQVAIINNTMCNHLFKKPDFRINIWGDMVCAGSPEGGKDACFAKLTYAAPQGDSGGPLVC 266

  Fly   242 KSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKERMV 283
            .....:.||||||:|......|.|.|||.:|....||:..|:
  Rat   267 NQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIRLTMI 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 76/265 (29%)
Tryp_SPc 47..280 CDD:238113 76/266 (29%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 76/265 (29%)
Tryp_SPc 58..304 CDD:238113 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24256
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.