DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG33127

DIOPT Version :8

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster

Alignment Length:283 Identity:87/284 (31%)
Similarity:133/284 (47%) Gaps:34/284 (12%)


  Fly    15 LLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCG 79
            ||||.|....|....:.| :..|:.....|..::.||||...:.|||.||:. |||: ...|.||
  Fly    10 LLALAGAAKLPHIQHLTL-RDTEQVHAEIQPLIIDGYDVQGVDNVPYLVSLS-LTRA-TYTHLCG 71

  Fly    80 GSLIAPNRVLTAAHCV------NGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQEL---- 134
            .|:|....:|||||||      || :|....|.|||  :|.|:...:||:..:....::..    
  Fly    72 ASIIGKRWLLTAAHCVDELRTFNG-DAVGTPVYAGI--INRSNVTAAQVRYVDFASTHRSFNGNA 133

  Fly   135 VTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFA-KYPTVLQKL 198
            .:.:||:|.:...||.: .||..|.:...:...:::.....|||.     |.|.. :|...||..
  Fly   134 GSDNIALLHVSESFEYN-ARVQQIALPDINDDYSNKTAAAYGWGL-----TDPDGDEYSKELQYA 192

  Fly   199 DYKTLSNSKCKETM---TQLTDTEICALERFGKGACNGDSGGPLVM--KSGESYKQVGVVSYGTA 258
            ....|:::.|||.:   ..||..::|:..:    .|.||.|.||:.  .:|.: :.||:.|:...
  Fly   193 FAPLLNSTGCKELLPADAPLTAQQVCSQVK----TCYGDGGTPLIYWPITGPA-ELVGLGSWSYM 252

  Fly   259 FCA-SNNPDVYTRVSMFDGWIKE 280
            .|. :|.|.|||.|..:.|||.:
  Fly   253 PCGYANRPTVYTSVPPYIGWIHQ 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 77/249 (31%)
Tryp_SPc 47..280 CDD:238113 78/250 (31%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 78/252 (31%)
Tryp_SPc 41..273 CDD:214473 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.