DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Tpsb2

DIOPT Version :8

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus

Alignment Length:301 Identity:87/302 (29%)
Similarity:133/302 (44%) Gaps:69/302 (23%)


  Fly     9 LLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGK 73
            |||   ||||     .|:.:::    :.....:..:..:|||.:..|.:: |:|||::|  :...
  Rat     4 LLL---LLAL-----SPLASLV----HAAPCPVKQRVGIVGGREASESKW-PWQVSLRF--KFSF 53

  Fly    74 MRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENY----QEL 134
            ..||||||||.|..||||||||            |:. :.....||.|     :.|.|    .:|
  Rat    54 WMHFCGGSLIHPQWVLTAAHCV------------GLH-IKSPELFRVQ-----LREQYLYYADQL 100

  Fly   135 VT----------------SDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHF 183
            :|                :|||:|:::.|..:......|.....|:...:.....:||||.:  .
  Rat   101 LTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDI--D 163

  Fly   184 GTGP-FAKYPTVLQKLDYKTLSNSKCK----------ETMTQLTDTEICALERFGKGACNGDSGG 237
            ...| ...||  |:::....:.||.|.          :.:..:.|..:|| ......:|.|||||
  Rat   164 SDEPLLPPYP--LKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCA-GNTRSDSCQGDSGG 225

  Fly   238 PLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            |||.|...::.|.||||:|.....:|.|.:||||:.:..||
  Rat   226 PLVCKVKGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 78/263 (30%)
Tryp_SPc 47..280 CDD:238113 79/264 (30%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 79/264 (30%)
Tryp_SPc 30..266 CDD:214473 78/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24256
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.