| Sequence 1: | NP_650166.2 | Gene: | CG12256 / 14462452 | FlyBaseID: | FBgn0038002 | Length: | 283 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011538852.1 | Gene: | CTRC / 11330 | HGNCID: | 2523 | Length: | 280 | Species: | Homo sapiens |
| Alignment Length: | 201 | Identity: | 60/201 - (29%) |
|---|---|---|---|
| Similarity: | 96/201 - (47%) | Gaps: | 34/201 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MNGVTYFVLLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSM 65
Fly 66 QFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSG-FRSQVQSYEMNE 129
Fly 130 NYQE-LVTSDIAILKIDPPFELDEKRVSTIDVS----GSDMVGADQEVLLTGWGSVFHFGTGPFA 189
Fly 190 KYPTVL 195 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12256 | NP_650166.2 | Tryp_SPc | 46..278 | CDD:214473 | 50/156 (32%) |
| Tryp_SPc | 47..280 | CDD:238113 | 49/155 (32%) | ||
| CTRC | XP_011538852.1 | Tryp_SPc | 29..>163 | CDD:214473 | 47/139 (34%) |
| Tryp_SPc | 30..>173 | CDD:238113 | 48/153 (31%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S5242 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.860 | |||||