Sequence 1: | NP_650166.2 | Gene: | CG12256 / 14462452 | FlyBaseID: | FBgn0038002 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011538852.1 | Gene: | CTRC / 11330 | HGNCID: | 2523 | Length: | 280 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 60/201 - (29%) |
---|---|---|---|
Similarity: | 96/201 - (47%) | Gaps: | 34/201 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNGVTYFVLLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSM 65
Fly 66 QFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSG-FRSQVQSYEMNE 129
Fly 130 NYQE-LVTSDIAILKIDPPFELDEKRVSTIDVS----GSDMVGADQEVLLTGWGSVFHFGTGPFA 189
Fly 190 KYPTVL 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12256 | NP_650166.2 | Tryp_SPc | 46..278 | CDD:214473 | 50/156 (32%) |
Tryp_SPc | 47..280 | CDD:238113 | 49/155 (32%) | ||
CTRC | XP_011538852.1 | Tryp_SPc | 29..>163 | CDD:214473 | 47/139 (34%) |
Tryp_SPc | 30..>173 | CDD:238113 | 48/153 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S5242 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |