DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and si:dkey-32n7.7

DIOPT Version :8

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio

Alignment Length:251 Identity:83/252 (33%)
Similarity:123/252 (49%) Gaps:28/252 (11%)


  Fly    41 LNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQ-NASRIS 104
            :||....|||.:.....: |:|.|:.:.  ||:.   ||||||....||:||||.||| |...::
Zfish   302 VNSSNGTVGGQNSSAVHW-PWQASLYWY--SGQT---CGGSLINKEWVLSAAHCFNGQRNGFYLT 360

  Fly   105 VVAGIRDLN--DSSGFRSQVQS------YEMNENYQELVTSDIAILKIDPPFEL-DEKRVSTIDV 160
            |:.|.:..|  |.|.....|::      |..|.|     .:|||::::..|... |..|...:..
Zfish   361 VILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTN-----DNDIALVRLSFPITFTDSIRPVCLAA 420

  Fly   161 SGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCK--ETMTQLTDTEICA- 222
            .|| :..:|.|..:|.|.::   ..|.....|.:.|:::...:.|.:|.  ..:..:||..||| 
Zfish   421 EGS-VFNSDTESWITTWRNI---SDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAG 481

  Fly   223 LERFGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            |.:.||..|.||||||:|......:.|.|:||:|:....|..|.||||||.:..||
Zfish   482 LLKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 80/245 (33%)
Tryp_SPc 47..280 CDD:238113 81/246 (33%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 80/243 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.