DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gas7 and Nedd4

Sequence 1:XP_006532265.1 Gene:Gas7 MGIID:1202388 Length:476 Species:Mus musculus
Sequence 2:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster

Alignment Length:412 Identity:76/413 (18%)
Similarity:127/413 (31%) Gaps:136/413 (33%)


Mouse    64 GMVPPPPGE----ESQTVILPPGWHSYLSPQGRRYYVNTTTNETTWERPS-SSPGISASPGPHRS 123
            |...|.|.:    |.....||.||...:...||.:|::..|..|.||.|. |:|.|:....|:..
  Fly   563 GRASPMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSR 627

Mouse   124 SLPTTVNGYHAS-GTPAHPPETAHMSLRKST--GDSQNLGSSSPGRKQSKENTI-TINCVTFPHP 184
            ........:.:. ..|.:.|....:.:|:::  .||..:.||     .:|.:.: |...|.|...
  Fly   628 DYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISS-----VTKTDLLKTKLWVEFEGE 687

Mouse   185 DTMPEQQLLKPTEWSYC-------------DYFWADKKDPQGN-----------------GTVAG 219
            ..:....|.:  ||.|.             :|...|....|.|                 |.:||
  Fly   688 TGLDYGGLAR--EWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAG 750

Mouse   220 -----------------FELLLQKQLKGKQMQKEMSEFIRERIKIEEEYAKNLAKLSQN------ 261
                             ::::|||.:..|.|:           .::.||..:|..:.:|      
  Fly   751 MAVYHGKLLDAFFIRPFYKMMLQKPIDLKDME-----------SVDTEYYNSLMWIKENDPRILE 804

Mouse   262 ----------SLAAQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKD-- 314
                      ...:|.|...|.|...|.....|| .:.|....:..:.|::.:.:|.:.|...  
  Fly   805 LTFCLDEDVFGQKSQHELKPGGANIDVTNENKDE-YIKLVIEWRFVARVKEQMSSFLDGFGSIIP 868

Mouse   315 ---MKKCDHHIADLRKQLASRYASVEKARKALTERQKDLEMKTQQLEIKLSNKTEEDIKKARRKS 376
               :|..|.|                                  :||:.:......|:|..|..:
  Fly   869 LNLIKIFDEH----------------------------------ELELLMCGIQNIDVKDWRENT 899

Mouse   377 TQAGDDLMRCVDLYNQAQSKWF 398
            ...||..|      |....:||
  Fly   900 LYKGDYHM------NHIIIQWF 915

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763
WW_FCH_linker 109..201 CDD:293229 19/97 (20%)
F-BAR_GAS7 214..446 CDD:153333 38/241 (16%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 12/32 (38%)
HECTc 650..1003 CDD:238033 54/326 (17%)
HECTc 674..1003 CDD:214523 48/297 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.