DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fzd9 and fz2

Sequence 1:NP_034376.1 Gene:Fzd9 MGIID:1313278 Length:592 Species:Mus musculus
Sequence 2:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster

Alignment Length:615 Identity:252/616 (41%)
Similarity:341/616 (55%) Gaps:110/616 (18%)


Mouse    17 LATGGAALEIGRFDPERGRGPAP--------------CQAMEIPMCRGIGYNLTRMPNLLGHTSQ 67
            :..||..|:         ..|||              |:.:.||||||||||:|..||.:.|.:|
  Fly    36 MGMGGHGLD---------ASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQ 91

Mouse    68 GEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNF 132
            .||..::.:|.|||:..|...|:|||||:|.|:|.:....|:|.||.:||:||..|||||:|::|
  Fly    92 DEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSF 156

Mouse   133 GWPDSLDCARLPTRNDPHALCMEAP---ENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPGSG 194
            .||:.:.|..||...||..||||.|   |..:.|.:....|.|....:....:..|..:.|.|:|
  Fly   157 EWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAG 221

Mouse   195 GT----------------CDNP--EKFQYVEKSRSC----------------------------- 212
            |:                |.||  ||....|.|.||                             
  Fly   222 GSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWY 286

Mouse   213 ----------APRCG-PGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPER 266
                      .|.|| |....|:|..:||||.:|:|:||.|||.||..|:.||:::..||:||||
  Fly   287 MNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPER 351

Mouse   267 PIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTG---CTLVFLLLYYFGMAS 328
            ||:|||.||.:.::.:|.|.....:.:|||   |.|  ::|  .:||   |||||||.|:|||||
  Fly   352 PIVFLSACYFMVAVGYLSRNFLQNEEIACD---GLL--LRE--SSTGPHSCTLVFLLTYFFGMAS 409

Mouse   329 SLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVAS 393
            |:|||:|:.|||||||.|||:|||..|..|||:|||.:|.::::.||.|..|.||.:.|:|||.:
  Fly   410 SIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGN 474

Mouse   394 MDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKT-----GGTNTEKLEKLMVKIGVFS 453
            ::|..|..|||.||..|||:||:||:.|||:||.||.::|.     .|...:||||||::||:||
  Fly   475 LNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFS 539

Mouse   454 ILYTVPATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMS 518
            :|||||||.||.||:||....:.| ::|...||.....||.:          |..:|.|||.||:
  Fly   540 VLYTVPATIVIGCYLYEAAYFEDW-IKALACPCAQVKGPGKK----------PLYSVLMLKYFMA 593

Mouse   519 LVVGITSGVWVWSSKTFQTWQSLCYRKMAA 548
            |.||||||||:||.||.::|:....|.:.|
  Fly   594 LAVGITSGVWIWSGKTLESWRRFWRRLLGA 623

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fzd9NP_034376.1 CRD_FZ9 36..162 CDD:143572 63/143 (44%)
Required for Wnt-activated receptor activity. {ECO:0000250|UniProtKB:Q8K4C8} 59..173 51/117 (44%)
7tmF_FZD9 222..543 CDD:320164 163/329 (50%)
TM helix 1 231..256 CDD:320164 14/25 (56%)
TM helix 2 265..286 CDD:320164 11/21 (52%)
TM helix 3 315..341 CDD:320164 20/26 (77%)
TM helix 4 358..374 CDD:320164 7/16 (44%)
TM helix 5 396..426 CDD:320164 18/30 (60%)
TM helix 6 445..472 CDD:320164 19/27 (70%)
TM helix 7 504..529 CDD:320164 16/25 (64%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. {ECO:0000250} 533..538 2/5 (40%)
Required for CTNNB1 accumulation and TCF transcription factor activity. {ECO:0000250|UniProtKB:Q8K4C8} 555..592
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 59/119 (50%)
Frizzled 308..618 CDD:279827 163/328 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D237456at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.