DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fshr and rk

Sequence 1:NP_038551.3 Gene:Fshr MGIID:95583 Length:692 Species:Mus musculus
Sequence 2:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster

Alignment Length:904 Identity:251/905 (28%)
Similarity:369/905 (41%) Gaps:290/905 (32%)


Mouse    18 CHHWL---CHCSNRV----FLCQDSKVTEIPPDLPRNAIELRF---VLTK--------------- 57
            |..||   |||:..:    ..|:...:..:|.:||...:.|..   .|||               
  Fly   144 CERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEANSFFMAPNLEEL 208

Mouse    58 ------------------------------LRVIPKGSFSGFGDLEKIEISQNDVLEVIEADVFS 92
                                          |:.:|..||.|...|..::::.| .|..::.|...
  Fly   209 TLSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSLQLNGN-ALVSLDGDCLG 272

Mouse    93 NLPNLHEIRIEKANNLLY-------------------------INPEAFQNLPSLRYLL------ 126
            :|..|..:|:|  .||.|                         ||.|.|..:|:|..||      
  Fly   273 HLQKLRTLRLE--GNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQI 335

Mouse   127 --ISNTGIKHLPA-----------------FHKIQSLQKV--------------------LLDIQ 152
              ||...:|:|.|                 ..|:..||::                    :||::
  Fly   336 MKISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMR 400

Mouse   153 DNINIHIIARNSFMGL---------------SFESV-------ILWLNKNGIQEI---------- 185
            .| .:..|:..:|.|:               ||..:       ||.|::.||||:          
  Fly   401 AN-PLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPR 464

Mouse   186 -----------------HNC-------------------AFNG-TQLDELNLSDNNNLEELPDDV 213
                             .:|                   .||| .||::|.|| .|.::.||.|.
  Fly   465 LKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLS-YNRIKALPQDA 528

Mouse   214 FQGASGPVVLDISRTKVY------------------------SLPNHGLENLKKLRARSTYRLKK 254
            |||.....:||:...::.                        .||..||..|..|:..:..:|::
  Fly   529 FQGIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLRE 593

Mouse   255 LPSLDKFVMLIEASLTYPSHCCAF-----ANWRRQTSE--------------------------- 287
            .|..|.|..:....|:|..|||||     .:.:::||:                           
  Fly   594 FPPPDTFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWP 658

Mouse   288 ------------LHPICNKSISRQDIDDMTQPGDQRVSLVDDE---------PSYGKG------S 325
                        :|.....:|:..:....||.|.|..:...:|         |:.|.|      |
  Fly   659 QMHNLSKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFS 723

Mouse   326 DMLYSEFDYDLCNEFVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNTTVLVVLTTSQ 390
            .|...:|...      .|.|.|.|..|.||.|:..:..||..:|.:.:|::.||.||:.||..|:
  Fly   724 GMSTEDFQPG------SVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSR 782

Mouse   391 YKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELS 455
            .|:.|||||:||||.||..:||||.::|.||..|..::..:||.||....|..:||..|.:||||
  Fly   783 SKMDVPRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELS 847

Mouse   456 VYTLAAITLERWHTITHAMQLECKVQLCHAASIMVLGWAFAFAAALFPIFGISSYMKVSICLPMD 520
            |||||.|||||.:.||||:.|..::.|..|..||.:||.||...||.|:.|:|.|.|.::|||.:
  Fly   848 VYTLAVITLERNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAVCLPFE 912

Mouse   521 IDS-PLSQLYVMALLVLNALAFVVICGCYTHIYLTVRNPNIVSSSRDTKIAKRMATLIFTDFLCM 584
            ..: |.|..||::|:.:|..||:.:.|||..:|..:|... ..::.|::||||||.|:||||||.
  Fly   913 TTTGPASLTYVISLMFINGCAFLTLMGCYLKMYWAIRGSQ-AWNTNDSRIAKRMALLVFTDFLCW 976

Mouse   585 APILFFAISASLKVPLITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRDFFVLMSKF 643
            :||.||:|:|...:.||::.:|||..|...|:|||.|||||||.||.|::|...|...|
  Fly   977 SPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVTLCKHF 1035

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FshrNP_038551.3 LRRNT 17..45 CDD:279764 9/34 (26%)
leucine-rich repeat 48..71 CDD:275380 9/71 (13%)
LRR 1 49..72 9/71 (13%)
LRR_8 72..132 CDD:290566 21/93 (23%)
leucine-rich repeat 72..96 CDD:275380 5/24 (21%)
LRR 2 73..97 4/24 (17%)
leucine-rich repeat 97..121 CDD:275380 11/49 (22%)
LRR 3 98..118 9/45 (20%)
LRR 4 119..143 10/49 (20%)
leucine-rich repeat 122..143 CDD:275380 9/46 (20%)
leucine-rich repeat 144..172 CDD:275380 10/63 (16%)
LRR 5 144..169 8/60 (13%)
LRR 6 170..192 11/75 (15%)
leucine-rich repeat 173..194 CDD:275380 11/75 (15%)
LRR_8 193..245 CDD:290566 20/76 (26%)
LRR 7 193..216 11/23 (48%)
leucine-rich repeat 195..219 CDD:275380 11/24 (46%)
LRR 8 217..240 6/47 (13%)
leucine-rich repeat 220..243 CDD:275380 7/47 (15%)
LRR 9 241..259 4/18 (22%)
GnHR_trans 282..348 CDD:289164 18/120 (15%)
7tm_1 378..625 CDD:278431 119/248 (48%)
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380 4/21 (19%)
LRR_RI 180..>383 CDD:238064 36/206 (17%)
leucine-rich repeat 183..204 CDD:275380 4/21 (19%)
LRR_8 203..263 CDD:290566 7/61 (11%)
leucine-rich repeat 205..228 CDD:275380 0/23 (0%)
leucine-rich repeat 229..252 CDD:275380 5/23 (22%)
LRR_8 252..311 CDD:290566 11/62 (18%)
leucine-rich repeat 253..276 CDD:275380 5/24 (21%)
leucine-rich repeat 277..300 CDD:275380 6/25 (24%)
LRR_8 299..359 CDD:290566 13/60 (22%)
leucine-rich repeat 301..324 CDD:275380 5/23 (22%)
leucine-rich repeat 325..348 CDD:275380 7/23 (30%)
LRR_RI 327..567 CDD:238064 43/242 (18%)
leucine-rich repeat 349..371 CDD:275380 1/22 (5%)
LRR_8 370..425 CDD:290566 8/56 (14%)
leucine-rich repeat 372..393 CDD:275380 2/21 (10%)
leucine-rich repeat 394..415 CDD:275380 6/22 (27%)
leucine-rich repeat 418..486 CDD:275380 10/68 (15%)
leucine-rich repeat 441..464 CDD:275378 7/23 (30%)
LRR_8 487..545 CDD:290566 17/59 (29%)
leucine-rich repeat 487..510 CDD:275380 3/23 (13%)
leucine-rich repeat 511..534 CDD:275380 11/24 (46%)
LRR_8 533..589 CDD:290566 8/56 (14%)
leucine-rich repeat 535..558 CDD:275380 2/23 (9%)
leucine-rich repeat 559..580 CDD:275380 4/21 (19%)
7tm_4 764..>892 CDD:304433 63/128 (49%)
7tm_1 770..1017 CDD:278431 119/248 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.