DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Akr1b8 and CG2767

Sequence 1:NP_032038.1 Gene:Akr1b8 MGIID:107673 Length:316 Species:Mus musculus
Sequence 2:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster

Alignment Length:318 Identity:131/319 (41%)
Similarity:197/319 (62%) Gaps:14/319 (4%)


Mouse     4 FVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAV 68
            |:..:...|||::|:|||::...:::.|:.||::|||||||.|..|.||..:|..::..:....|
  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70

Mouse    69 QREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKE-LFPKDDQGRIL 132
            :||:||||:|:.|.......::...:|:|.||:|||:||||:|.|..:...:: .|..|.:|.:.
  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135

Mouse   133 TSKTTFLEA-WEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKL 196
            ...||...| |..||.||::||.|::|||||:..|:.|||.  ..|.:|..||:|.|.||.|..|
  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDL 198

Mouse   197 IQYCHSKGISVTAYSPLGSPDRPSAK--------PEDPSLLEDPKIKEIAAKHEKTSAQVLIRFH 253
            :.:|.|:.|:|||||||||  :..||        .:.|.|::.|::|||||.|.||.||||:|:.
  Fly   199 VDFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWI 261

Mouse   254 IQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLLPETVNMEEYP 311
            |...|..||||..|:|:::|:.||||:|:.||:|.:.|.::|.|.|.......:|.:|
  Fly   262 IDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHP 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Akr1b8NP_032038.1 ARA1 1..297 CDD:223729 127/303 (42%)
Tas 16..289 CDD:223739 121/283 (43%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 126/300 (42%)
Tas 10..297 CDD:223739 124/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.