DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fgfr3 and drpr

Sequence 1:XP_006503776.1 Gene:Fgfr3 MGIID:95524 Length:837 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:370 Identity:70/371 (19%)
Similarity:123/371 (33%) Gaps:109/371 (29%)


Mouse    24 CVP-WLPGGATRAAP------GCARWQRGKAEQRSGGRPREGRLSLEVPGPEPSQQEQVA----F 77
            |:| |.......:.|      |||  ||.:.......|..:|....|. |...::.::|.    :
  Fly   685 CLPGWTGSNCNESCPTDTYGQGCA--QRCRCVHHKVCRKADGMCICET-GWSGTRCDEVCPEGFY 746

Mouse    78 G-------SGDTVELSCHPPGGAPTGPTVWAKDGTG-----LVASHRILVGPQRLQVLNASHEDA 130
            |       :..:....||...|.     |.....||     |:||.||..     |..|:|....
  Fly   747 GEHCMNTCACPSANFQCHAAHGC-----VCRSGYTGDNCDELIASQRIAD-----QSENSSRASV 801

Mouse   131 G-------VYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVA-----EDTGAPYWTRPERMDK 183
            .       :::|   :...|..::..||::..:        ::|     .||..|.|......|.
  Fly   802 ALTLVLMTLFAC---IIFAVFIYYRRRVSNLKT--------EIAHVHYTHDTNPPSWPPNHNFDN 855

Mouse   184 KLLAVPAANTVRFRCPAAGNPTPSISWLKN-----------GKEFRGEHRIGGIKTNYLQLRHQQ 237
            .:..:.|...:.        |....|.:.|           |.:.....|:|....||   .|. 
  Fly   856 PVYGMQAETRLL--------PNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINY---NHD- 908

Mouse   238 WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHR-----PILQAGLPANQTAILGSD 297
               ::...:.:||.|  .:|.|:  |:::.:..|.::   |:     |:      ...:.||..:
  Fly   909 ---LLTKNLNADRTN--PIVYNE--SLKEEHVYDEIK---HKEGYKDPV------KIYSKILFPE 957

Mouse   298 VEFHCKVYS----DAQPHIQWLKH--VEVNGSKVGPDGTPYVTVL 336
            .|:....||    ..:||...:..  :.:|..:..|.....:|||
  Fly   958 DEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKNMTVL 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fgfr3XP_006503776.1 IGc2 79..138 CDD:197706 15/71 (21%)
IG 80..136 CDD:214652 15/68 (22%)
Ig2_FGFR 183..272 CDD:143265 17/100 (17%)
IG_like 287..382 CDD:214653 12/57 (21%)
Ig3_FGFR 295..383 CDD:143175 10/49 (20%)
PTKc_FGFR3 490..823 CDD:173652
Pkinase_Tyr 503..779 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.