DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: F2rl2 and AstC-R1

Sequence 1:NP_034300.3 Gene:F2rl2 MGIID:1298208 Length:369 Species:Mus musculus
Sequence 2:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster

Alignment Length:380 Identity:94/381 (25%)
Similarity:169/381 (44%) Gaps:55/381 (14%)


Mouse    12 LFLPVTVCQSGINVSDNSAKPTLTIKSFNGGPQNTFEEFPLSDI-EGWTGATTTIKAECPEDSI- 74
            |.:.|.....|...:|:.|..|        ...||.|....::: ..|...::||:   ||:|: 
  Fly     5 LMMDVLQFVKGEMTADSEANAT--------NWYNTNESLYTTELNHRWISGSSTIQ---PEESLY 58

Mouse    75 -STLHVNNATIGYLRSSLSTQVIPAIYILLFVVGVPANIVTLWKLSLRTKSISLV--IFHTNLAI 136
             :.|......|. .|:|.:......:|..:.::|:..|.:.:: :.||...:..|  |:..|||:
  Fly    59 GTDLPTYQHCIA-TRNSFADLFTVVLYGFVCIIGLFGNTLVIY-VVLRFSKMQTVTNIYILNLAV 121

Mouse   137 ADLLFCVTLPFKIAYHLNGNNWVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQ 201
            ||..|.:.:|| :.|.:...:|.|||..|:...|......:.:.:.|..|..:||:|..||.:..
  Fly   122 ADECFLIGIPF-LLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSP 185

Mouse   202 KLPKRSFSMLMCGMVWVMVFLYMLPFVI----LKQEYHLVHSEITTCHDV-VDACE--SPSSFRF 259
            :......:.::..:.|....:.|||.::    ::||..:.:|    |:.: .||.:  |.::|..
  Fly   186 RYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDGINYS----CNIMWPDAYKKHSGTTFIL 246

Mouse   260 YYFVSLAFFGFLIPFVIIIFCYTTLIHKLKS-----------KDRIWLGYIKAVLLILVIFTICF 313
            |.|    |.||..|...|:..|..:|.||:|           |.|......:.||.::.::.:|:
  Fly   247 YTF----FLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCW 307

Mouse   314 AP---TNIILVIHHANYYYHNTDSLYFMYLIALCLGSL---NSCLDPFLYFVMSK 362
            .|   :.:.|:  |:|....:...|..  ||.|.||:|   ||.::|.||..:|:
  Fly   308 LPHWISQVALI--HSNPAQRDLSRLEI--LIFLLLGALVYSNSAVNPILYAFLSE 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
F2rl2NP_034300.3 7tm_4 104..>312 CDD:304433 56/228 (25%)
7tm_1 112..357 CDD:278431 70/271 (26%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 74/286 (26%)
7tm_1 94..353 CDD:278431 71/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.