DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eya1 and eya

Sequence 1:XP_006495509.1 Gene:Eya1 MGIID:109344 Length:609 Species:Mus musculus
Sequence 2:NP_723188.1 Gene:eya FlyBaseID:FBgn0000320 Length:766 Species:Drosophila melanogaster

Alignment Length:712 Identity:277/713 (39%)
Similarity:347/713 (49%) Gaps:219/713 (31%)


Mouse    28 SHINSTSMTPNGTEVKTEPMSSSEIASTAADGSLDSFSGSALGSSSFSPRPAHPFSPP------- 85
            || :||.:..||      |.|:.........|...|..|...|....||....|.|.|       
  Fly    73 SH-SSTVLASNG------PSSAGAGMGVGVGGGGGSGGGVGGGVGQCSPLGLPPQSQPLQPTIGS 130

Mouse    86 -----QIYPSNRSYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAG 145
                 ..|.:..:.|::  ..||.::|    |..:......::::||.|.|...|         |
  Fly   131 LASLSGHYSNGNANPNV--NSSSCSLA----TASSFAQSAGSSFSTYQQAGGTSG---------G 180

Mouse   146 IKTESGL----------------------SQSQSPGQ----------TGFLSYGTS--------- 169
            :..|.|:                      |:|:||||          .|...||.|         
  Fly   181 VSGEDGVVGGATVMSHWTHDGTGSSAAVKSESRSPGQVHASLDNGSVAGSNLYGCSSASNPLDGG 245

Mouse   170 ----------------------------------------FGTP------------QPGQAPYSY 182
                                                    :|||            :||.|    
  Fly   246 AVAVNSSAVAAAAAAVYDGKHDYYYYNSMQQYTPPPFYSGYGTPYAAATAARQAKMEPGAA---- 306

Mouse   183 QMQGSSFTTSSGLYSGNNSLTNSSGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSP 247
             ...:::.|.|...||||   ||..::|   .|..|..|||..|..|||.. | .:|.:.:|.||
  Fly   307 -AAAAAYLTPSYAASGNN---NSQLYSS---PYAGYNNFGQQDYGGYYNEQ-Y-GNYYSPANYSP 362

Mouse   248 ---TTPSTNATY----------QLQEPPSGVTSQAVTDPTAEYSTIHSPSTPIKETDSERLRRG- 298
               ::||::|::          .|.|.|:...|   |.|.  :.|.|||.:|:..:.|.....| 
  Fly   363 YAVSSPSSSASHGHGFHVAASSNLSESPTDTHS---TTPV--HQTTHSPHSPLPISPSTGSGIGP 422

Mouse   299 ---------------SDGKS---------------------RGRGRRNNNPSP------------ 315
                           |.|.|                     |.||||:..|||            
  Fly   423 LGNVSAAAAAAALNSSGGSSVGTAGSGGVATSKTTPTGKTGRARGRRHQQPSPTRSTASDTGNSE 487

Mouse   316 ---PPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGLRMEEMIFNLADTHLFFN 377
               ||    ||||:||||||:|:||:||:|||||||.:|..:.:::..|||||:||:||||.|||
  Fly   488 AVKPP----ERVFVWDLDETLIIFHTLLSGSYANRYTKDHSSLMTIAFRMEEMVFNMADTHFFFN 548

Mouse   378 DLEECDQVHIDDVSSDDNGQDLSTYNFGTDGF----PAAATSANLCLATGVRGGVDWMRKLAFRY 438
            ::|||||||||||||||||||||.|||.||||    |..| ..||||.|||||||||||||||||
  Fly   549 EIEECDQVHIDDVSSDDNGQDLSAYNFATDGFHTNTPPGA-PPNLCLPTGVRGGVDWMRKLAFRY 612

Mouse   439 RRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLTLALKALSLIHSRTNCVNILVTTT 503
            |::|:|||:|:.|||.||||.|||||||:|:|||..||:|.|||||.||:|..|.||||:|||:|
  Fly   613 RKIKDIYNSYRGNVGTLLGPGKREAWLQIRSEIEVATDNWATLALKCLSMISQRENCVNVLVTST 677

Mouse   504 QLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFERIIQRFGRKVVYVVIGDGVEEEQGAK 565
            ||.||||||||:|||.:|.|||||||.|||.|:|:|||:.|||||..|||||||.|||..||
  Fly   678 QLAPALAKVLLFGLGGIFNIENIYSAHKIGHETCYERIVTRFGRKSTYVVIGDGNEEETAAK 739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eya1XP_006495509.1 G_path_suppress <73..262 CDD:292610 63/307 (21%)
EYA-cons_domain 321..565 CDD:273739 177/248 (71%)
Hydrolase 323..567 CDD:279092 177/248 (71%)
eyaNP_723188.1 DUF3682 413..>485 CDD:289231 13/72 (18%)
EYA-cons_domain 492..766 CDD:273739 179/254 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 426 1.000 Inparanoid score I1727
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000618
OrthoInspector 1 1.000 T615832
orthoMCL 1 0.900 OOG5_129664
Panther 1 1.100 O PTHR10190
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3984
TreeFam 1 0.960
98.850

Return to query results.
Submit another query.