DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tre1 and Gpr15

Sequence 1:NP_001284901.1 Gene:Tre1 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001099360.1 Gene:Gpr15 RGDID:1306639 Length:360 Species:Rattus norvegicus

Alignment Length:311 Identity:69/312 (22%)
Similarity:127/312 (41%) Gaps:46/312 (15%)


  Fly    26 TQSIYPHSATLFAAISACVFVTIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSL 90
            |.|...:::.........||:| |||||.| |:..|............|:|:|:.||.:|. .:|
  Rat    25 TPSHTSYTSVFLPVFYTAVFLT-GVLGNFI-LMVTLHFKHRNRRLIDIFIINLAASDFIFL-VTL 86

  Fly    91 PLTAVRFFQES---WTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKF 152
            ||...:  :.|   |..|:.|||........|:..::..:..::::||:.|...:...::.:...
  Rat    87 PLWVDK--EASLGLWRTGSLLCKGSSYTISVNMHCNVFLLTCMSMDRYLAIMRPTLARRLRRRSC 149

  Fly   153 ITLQLLFVWAVSFLLLLPPILGIWGEMGLDEATFSCTILKKEGRSIK----KTLFVIGFLLPCLV 213
            .......:|.:|.||.||.:|    ..||..........:|:..|:|    ....:..|.:|.|.
  Rat   150 AYAVCAVIWIISCLLGLPTLL----SRGLTHIEGKPYCAEKKPTSLKLMWGLVALIATFFVPLLS 210

  Fly   214 IIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFL 278
            |:.||.||...:....::...|:                        :|.|:..::.|::|..|.
  Rat   211 IVSSYCCITRRLCAHYQQSGKHN------------------------KKLRKSIKIIVIVVAAFT 251

  Fly   279 CFLVCFLPLMLANVVDD-ERNTSYPWLHI-----IASVMAWASSVINPIIY 323
            ...|.|..:.|..:|.. :..:.:|...:     :...:|:|:|.:||::|
  Rat   252 ISWVPFNTVKLLAIVSGLQPESQFPSESLQQAMKVTGSLAFANSCVNPLLY 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 60/284 (21%)
Gpr15NP_001099360.1 7tm_1 50..302 CDD:278431 60/284 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24228
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.