DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ces1e and Gli

Sequence 1:NP_598421.1 Gene:Ces1e MGIID:95432 Length:562 Species:Mus musculus
Sequence 2:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster

Alignment Length:577 Identity:172/578 (30%)
Similarity:263/578 (46%) Gaps:98/578 (17%)


Mouse    27 VDTVQGKVLGKYISLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSSVKNATSYPPMCFQD 91
            ||.|.|:              .:||||:|:|.||....||.||:....|..:: |..:.|.|.| 
  Fly   168 VDRVMGE--------------CSVFLGIPYALPPTFEGRFKPPRVHRGWQLLQ-AVDFGPACPQ- 216

Mouse    92 PV--TGQIVNDLLTNRKEKIPLQFSEDCLYLNIYTP-ADLTKSDRLPVMVWIHGGGLVLGGASTY 153
            ||  ||          ..|..:...|||||||:|:| .....:.:.||||:||||..:.|.::.:
  Fly   217 PVRYTG----------ATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASNLF 271

Mouse   154 DGLVLSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIAKFGGDPGSVTI 218
            .|.:|::..:||||.:.||||..||.|||||:|.||:|.|||..||.||.|||..|.||..|:|:
  Fly   272 QGHILASFYDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITL 336

Mouse   219 FGESAGGESVSVLVLSPLAKNLFQRAISESGVALTAGLV---KKNTRPLAEKIAVISGCKNTTSA 280
            ||..|||.|..:|:::|..:|:.:|.|::||.||....:   |...:..:..:..:.||...:|.
  Fly   337 FGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSW 401

Mouse   281 AMVHCLRQKTEEELLGTTLKLNLFKLDLHGDSRQ--SHPFVPTVLDGVLLP-------------- 329
            .:|:|||...           :.::|.....|.|  |.|:.|.:.....||              
  Fly   402 KLVNCLRTGR-----------SFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWR 455

Mouse   330 ---KMPEEILAEKNFN-TVPYIVGINKQEFGWILPTMMNYPPSDVKLDQMTAMSLLKKSSFLLN- 389
               :.||.::....|| .:.|:.|:..||..:.:....:..|. .:||.......:::..|..| 
  Fly   456 FLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPY-YELDGRFFDQKIREHVFRYNY 519

Mouse   390 -LPEDAIAVAIEKYLRDKDYT-----GRN---KDQLLELIGDVVFGVPSVIVSRGHRDAGAPTYM 445
             |..:.:..|| ||:    ||     ..|   :||.:.::.|:.:..|...:.:...:...|.||
  Fly   520 TLNPNGVYEAI-KYI----YTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYM 579

Mouse   446 YEFQYSPSFSSEMKPDTVVGDHGDEIYSVFGAPIL------------RGGTSEEEINLSKMMMKF 498
            |..  :.:..:...|......|..|.|.:.|||.:            |...::.:.|:|...|:.
  Fly   580 YVL--NTTVEALNLPQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQT 642

Mouse   499 WANFARNGNPNGQ---GLPHWPEYDQKEGYLQIGATTQQAQKL--KEKEVAFWTELL 550
            :.||||.|||..|   |:.....|..:..||.|..|...:..|  ::.|.||||:.|
  Fly   643 YTNFARYGNPTPQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYL 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ces1eNP_598421.1 COesterase 25..546 CDD:278561 169/572 (30%)
Aes 44..>242 CDD:223730 85/201 (42%)
Prevents secretion from ER. {ECO:0000255} 559..562
GliNP_476602.1 COesterase 134..695 CDD:278561 169/572 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89693486
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.