DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATF2 and kay

Sequence 1:NP_001243019.1 Gene:ATF2 HGNCID:784 Length:505 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:400 Identity:91/400 (23%)
Similarity:142/400 (36%) Gaps:76/400 (19%)


Human   160 TSAIVRPASLQVPNVLLTSSD------SSVIIQQAVPSPTSSTVI-----TQAPSSNRPIVPVPG 213
            |||.....:....|..:.:|:      :.:.:||.....|..:|:     |..|::.|.|....|
  Fly   201 TSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLG 265

Human   214 PFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRL 278
            ..     |.:.||..||..|..         |||.|.|..:.....|||...|..|:|....:.|
  Fly   266 HL-----LSDTQTDRVAGCAGF---------AVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLSL 316

Human   279 KAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQ--------------------PATSTT 323
            ......:....:..||..........|.|..:...|.|.                    .|.|::
  Fly   317 GQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSS 381

Human   324 ETPASPAHTTPQTQSTSGRR------RRAANEDPDEKRRKFL--ERNRAAASRCRQKRKVWVQSL 380
            ...||...:...|.:|..||      .|:.|..|:|::::.:  |||:.||:|||::|......|
  Fly   382 RGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNEL 446

Human   381 EKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKS---------------GYH 430
            .::.|.|......::.|:.:|.|...||:.||..|:   .|..:.:|               |..
  Fly   447 TEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHR---ATCQKIRSDMLSVVTCNGLIAPAGLL 508

Human   431 TADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMA 495
            :|....|.     .||.|......||..|..|:.:|..:...:.|.|......:.:..|..|...
  Fly   509 SAGSSGSG-----ASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDE 568

Human   496 PSSQSQPSGS 505
            |...:..|||
  Fly   569 PLDGAIDSGS 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATF2NP_001243019.1 Nuclear export signal 1 (N-NES) 1..7
C2H2 Zn finger 27..49 CDD:275370
GCN4_cent 65..102 CDD:213399
Herpes_BLLF1 <90..342 CDD:282904 44/213 (21%)
Essential for its histone acetyltransferase activity 296..299 0/3 (0%)
bZIP_ATF2 354..414 CDD:269835 19/62 (31%)
coiled coil 354..414 CDD:269835 19/62 (31%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 354..374 9/22 (41%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 380..408 7/28 (25%)
Nuclear export signal 2 (C-NES) 405..414 4/9 (44%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/61 (31%)
coiled coil 421..480 CDD:269869 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.