DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eps15l1 and Eps-15

Sequence 1:XP_006509607.1 Gene:Eps15l1 MGIID:104582 Length:923 Species:Mus musculus
Sequence 2:NP_611965.2 Gene:Eps-15 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster

Alignment Length:944 Identity:340/945 (36%)
Similarity:472/945 (50%) Gaps:178/945 (19%)


Mouse    18 LYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDKQGFYVALRLVAC 82
            :||:|||.:||..||.:.|..||.|||||||||::|.:||||:||.|||||||.||:|||:||:.
  Fly    15 VYEAYYKLIDPKGTGAIEAMTAAKFLKKSGLSDVVLSRIWDLSDPSGKGFLDKPGFFVALKLVSL 79

Mouse    83 AQSGHEVTLSSLSLTMP-PPKFHDTSSPL--------MATQSSAETHWAVRVEEKAKFDGIFESL 138
            :|:|...:::::.|.:. |||..:....:        :|:...|...|::.|.::.|::.:||||
  Fly    80 SQAGQVASMANIYLDIANPPKLGELPKTMPSRIQTVPVASGGVANGDWSIGVIDRLKYEQLFESL 144

Mouse   139 LPVNGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLDRDEFAVAMHLVYRALEKEPVPSI 203
            .|.||:|.|:|||.|||:||||:.:||.:|||:|.||||:||..||.|||||||:.|:|..:||:
  Fly   145 HPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQKRTIPSV 209

Mouse   204 LPP-------------PLIPPSKR-----------------------KKTVFAGAVPVLPASPPP 232
            |||             |.:||...                       |......|:|.||.:.||
  Fly   210 LPPELRKPGGAGPPPKPAMPPPPAGAAMPRAPSGEGFGDGGFVANFPKDIAPPAAIPPLPVAVPP 274

Mouse   233 KDSLRSTPSHGSVSS--LNSTGSLSPKHSVKQPPVA---WVVPVADKMRFDEIFLKTDLDLDGYV 292
               :...|..|:|||  |..|..|.|   :..|.:|   |||..||..||:|||.::|||.||.|
  Fly   275 ---MTRIPPVGAVSSQPLIQTDPLIP---IGAPVMANADWVVTPADLKRFEEIFRQSDLDKDGLV 333

Mouse   293 SGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKEQFALAMYFIQQKVSKGIDPPQVLSPDMV 357
            ||.|||:||:.||:.|..||.||||.||.|:|||:.|||||||:|:::| .:|:|||.||:.:||
  Fly   334 SGLEVKDIFIKSGIPQRSLADIWALCDTNQSGKLTVEQFALAMWFVERK-QRGVDPPHVLNANMV 397

Mouse   358 PPSERGTPI-----PDSSSTLASGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTS 417
            |||.|.|..     |.......|.     .||:.||:||.:|.||:..||.:|.:||..:|.|..
  Fly   398 PPSMRATVAGVDLQPQEVKPTYSN-----PELEMISKEIEELARERRVLETEIAQKEADVRIKNG 457

Mouse   418 EVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQTISSLKTQI 482
            ||:.||::||..|::|::||.|:.:||.|||::..|.:....:|::|........:.::.::.|.
  Fly   458 EVRSLQSELDTLTATLKQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQC 522

Mouse   483 QSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRAQLETILRSLKCTQDDINQARSKLSQ 547
            ..||..:..||.:||..:|||.:|:.||..|::...:...:|..:...|:.||..|:..||.::|
  Fly   523 HMQEVTINEQEGELNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQ 587

Mouse   548 LQESHLEAHRSL-----EQYDQVPDGVSGTSL---PDL----ATLNEGILLAERGGFGAMDDPFK 600
            |.|:..:...:|     ...:|..:.||...|   ||.    .||.:.:.|.:       ||||:
  Fly   588 LLETQRQMTDALLICRAAMENQNAELVSEYQLKIEPDFDEARKTLTKEVQLPK-------DDPFE 645

Mouse   601 NKALLFSNNSQELHPDPFQAEDPFKSDPFKGADPFKGDPFQSDPFSEQQTAATDPFGGDPFKES- 664
                  .|||...:    ||.:.|      |:|||.|.|......|   |...|.|......:| 
  Fly   646 ------ENNSGAAN----QATNGF------GSDPFSGQPVNKPAIS---TGFDDSFNMSSGFDSG 691

Mouse   665 -DPFHSSSSDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSISSKGSDPFGTLD-P 727
             |.|..|.:...| .||:.|||.||.|..|.|  :.:.|....|.|        |||||..|. |
  Fly   692 FDAFGQSGAGSAF-GQTQRDPFGSDAFAANKS--NAITPEPGKDDF--------GSDPFAALHAP 745

Mouse   728 FGSSSFSSAEGFADFSQMSKPPPSGPFSSSLGGTGFSDDPFKSKQDTPALPPKKP--APPRPKPP 790
            .|.....|..     :|.|.|||                  :.:..:|||||||.  .||||.||
  Fly   746 TGQGQVLSPN-----AQKSGPPP------------------RPESPSPALPPKKSKVPPPRPAPP 787

Mouse   791 SEA-AAGEKGTVVYTLLGGQSTPVSQLGSSDFPESPDPFQPLGADSGDPFQNK-----KGFGDPF 849
            ..| ..|..|:      ||..      |.:||               |.|.||     .......
  Fly   788 RAAQPTGGFGS------GGGG------GFADF---------------DDFDNKLHHIPSAPSPSA 825

Mouse   850 SGKDPFAPSSSAKPPKTSSSGFAD-FTSFGNEEQ 882
            :...|..|:..|..|..|.|...| ||.|.:..|
  Fly   826 TALSPLPPTLPAPIPVVSGSSLLDSFTLFDDPGQ 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eps15l1XP_006509607.1 EH 13..103 CDD:197477 48/86 (56%)
EH 19..85 CDD:238009 43/66 (65%)
EH 121..200 CDD:197477 45/79 (57%)
EH 131..196 CDD:238009 41/65 (63%)
EH 266..362 CDD:197477 59/99 (60%)
EH 277..343 CDD:238009 41/66 (62%)
SPEC 383..564 CDD:295325 60/186 (32%)
TPR_MLP1_2 396..523 CDD:285204 42/127 (33%)
Eps-15NP_611965.2 EH 16..82 CDD:238009 43/66 (65%)
EH 126..215 CDD:197477 50/89 (56%)
EH 137..202 CDD:238009 41/65 (63%)
EH 307..402 CDD:197477 58/96 (60%)
EH 318..384 CDD:238009 41/67 (61%)
RILP-like <445..548 CDD:304877 35/103 (34%)
Spc24 529..>584 CDD:285486 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0998
Hieranoid 1 1.000
Homologene 1 1.000 H31881
Inparanoid 1 1.050 458 1.000 Inparanoid score I1556
Isobase 1 0.950 0.721928 Normalized mean entropy S4078
OMA 1 1.010
OrthoDB 1 1.010 D360276at33208
OrthoFinder 1 1.000 FOG0000866
OrthoInspector 1 1.000 T617080
orthoMCL 1 0.900 OOG5_128866
Panther 1 1.100 LDO PTHR11216
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R396
TreeFam 1 0.960
1312.910

Return to query results.
Submit another query.