DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Epm2a and CG10089

Sequence 1:NP_034276.2 Gene:Epm2a MGIID:1341085 Length:330 Species:Mus musculus
Sequence 2:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster

Alignment Length:172 Identity:39/173 (23%)
Similarity:66/173 (38%) Gaps:43/173 (25%)


Mouse   155 HYSRILPNIWLGSCPRQLEHVTI---KLKHELGVTAVMNFQTEWDIIQNSSGCNRYPEPMTPDTM 216
            |..::||.:::|:.....:|..:   |:.|.:.:                   :..|..:.||  
  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAI-------------------HDSPRRLLPD-- 47

Mouse   217 MKLYKEEGLSYIWMPTPDMSTEGRVQMLPQ--AVC--LLHALLENGHTVYVHCNAGVGRSTAAVC 277
             |.|    |..:...|||       |.|.|  :||  .:||.......|.:||.||:.||.....
  Fly    48 -KHY----LCVMASDTPD-------QNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAV 100

Mouse   278 GWLHYVIGWNLRKVQYFIMAKRPAVYIDEDALAQAQ-QDFSQ 318
            .::......|.::....:.|.|...  :.:|..|:| |:|.|
  Fly   101 AYIMTATHLNWKEALKVVRAGRAVA--NPNAGFQSQLQEFEQ 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Epm2aNP_034276.2 CBM20_laforin 1..128 CDD:99881
Substrate binding. {ECO:0000250|UniProtKB:O95278} 102..106
PTPc 157..303 CDD:304379 32/153 (21%)
Glucan phosphatase signature motif CXAGXGR. {ECO:0000250|UniProtKB:O95278} 265..271 3/6 (50%)
Substrate binding. {ECO:0000250|UniProtKB:O95278} 266..271 2/5 (40%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 38/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.