DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CREB1 and kay

Sequence 1:NP_604391.1 Gene:CREB1 HGNCID:2345 Length:341 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:437 Identity:84/438 (19%)
Similarity:146/438 (33%) Gaps:125/438 (29%)


Human     8 ENQQSGDAAVTEAENQQMTVQAQP-----------------------QIATLAQVSMPAAHATSS 49
            :.||...|...:..:||..:..||                       .:|:.|..:...:|.:::
  Fly    44 QQQQQQQAPQQQLRHQQRQLPTQPAYQQSQSVAHNAFPLRSSSNNYGHVASSAYAASSGSHNSNN 108

Human    50 APTVTLV---------------QLP-NGQTVQVHGVIQAAQ---PSVIQSP----------QVQ- 84
            |..:..|               ||. |...:.::...|..|   ||..||.          |.| 
  Fly   109 AAAMAAVCQMQNFFNQQQQQQQQLEFNNNCMPINYYQQQQQQHYPSESQSSASGWNPETPGQAQL 173

Human    85 ---------TVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILND 140
                     |..::|.......:.|..::.|...|:..|.:...|:.:....|:         |:
  Fly   174 ALTATTCNTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLA---------NE 229

Human   141 LSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQ--------GGAI-QLANN 196
            |.....|  ..|..:|....:.|.:|..|  |...:.:.|..::.||        |.|: ::..|
  Fly   230 LFLQQLG--NFETGQSVLTLTTPTLTPTT--TRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPN 290

Human   197 GTD--------GVQGL---QTLTMT--------NAAATQPGTTILQYAQTTDGQQILVPSNQVV- 241
            ..|        ||..|   ||..::        ::.|:...|.:.:...|||.......|.... 
  Fly   291 AIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQA 355

Human   242 --VQAAS---GDVQTYQIRTAPTSTIAPGVVMASS----------------PALPTQPAEEAARK 285
              :.|.|   |.|..:....|..|:......:.||                |...|....|..:|
  Fly   356 GHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQK 420

Human   286 REVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKAL 332
            |.||..:|::||..||:::.:....|...|..||.:.:::.:|::.|
  Fly   421 RAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVL 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CREB1NP_604391.1 pKID 113..151 CDD:308015 6/38 (16%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 284..309 9/25 (36%)
bZIP_CREB1 285..339 CDD:269838 15/49 (31%)
coiled coil 286..338 CDD:269838 14/48 (29%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 311..332 5/21 (24%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 15/49 (31%)
coiled coil 421..480 CDD:269869 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.