DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CPB1 and CG8539

Sequence 1:NP_001862.2 Gene:CPB1 HGNCID:2299 Length:417 Species:Homo sapiens
Sequence 2:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster

Alignment Length:337 Identity:99/338 (29%)
Similarity:162/338 (48%) Gaps:22/338 (7%)


Human    92 VLISNLRN-VVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIY 155
            ||::.:.| :.||:...|.|......:.|..::.|..:..::|..:...::...:..|:|.||:.
  Fly    10 VLVTIVVNQLSEAREVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALK 74

Human   156 LLKV--GKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVL 218
            :..:  |.....|..||:|...|:|||::||.....:.:.|..:...   ::||...|::::|:.
  Fly    75 MAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWHIMPLA 136

Human   219 NIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIG--ASRNPCDETYCGPAAESEK 281
            |.|||.|:....|:||.|| |..|.:|.||:.||||...| .:|  ..::||||.|.|.:..||.
  Fly   137 NPDGYEYSRNTERYWRNTR-TPNGGNCFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSSPFSEV 199

Human   282 ETKALADFIRNKLSSIKA--YLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGT 344
            |.:.:.|.:...:.|.:|  ||::|:.::.:.||:.|......|..|.:.:.:.....:....||
  Fly   200 EARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGT 264

Human   345 ---KYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGR----YGFLLPESQIRATCEETF 402
               .:.|...|.|.   .|.|.|:|...|...||.||:..|||    |.|..|...||...||::
  Fly   265 FIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESW 326

Human   403 LAIKYVASYVLE 414
            ..||..|...:|
  Fly   327 TGIKAFAEKTIE 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CPB1NP_001862.2 Propep_M14 29..103 CDD:280416 4/12 (33%)
M14_CPB 114..413 CDD:199852 91/312 (29%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 176..179 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 251..252 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 305..306 0/1 (0%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 91/305 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70044577
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.