DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CPB1 and CG18585

Sequence 1:NP_001862.2 Gene:CPB1 HGNCID:2299 Length:417 Species:Homo sapiens
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:416 Identity:138/417 (33%)
Similarity:227/417 (54%) Gaps:23/417 (6%)


Human     1 MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELAS-TTQIDFWKP-DSVTQIKP 63
            :||.||.:|.|........|.::..:|:::.::::..:..|.::.. |.:.:.||. |..::   
  Fly     6 LLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDERSR--- 67

Human    64 HSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHS----YEKYNKWET 124
              .:|..|...:....:.:||.|.:..:::|.|::..::   :.:|..|..|    :.||.:.|.
  Fly    68 --QIDIMVSPGELNHFQELLKFNNISSELMIENVQERID---EEQVTPTADSATFGWTKYYELEE 127

Human   125 IEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVG-KAGQNKPAIFMDCGFHAREWISPAFCQW 188
            ||||..::....|::....::|.::|||.|..:|:. |||  .|.||::...||||||:.|...|
  Fly   128 IEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAG--NPGIFIESNIHAREWITSASATW 190

Human   189 FVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRN 253
            |:.:.:.:  .:..|..|.|..|::::||.|:||:.|:..|.|.|||||..|..::|||.|.|||
  Fly   191 FINQLLTS--EDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRN 253

Human   254 FDAGWCE-IGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYA 317
            ||:.|.: .|||.|||.||:.|...|||.|.|||.:::......|..|::.|||.|.::.||.:.
  Fly   254 FDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHT 318

Human   318 -YKLGENNAELNALAKATVKELASL-HGTKYTYGPGATTIYPAAGGSDDWAYDQ-GIRYSFTFEL 379
             .:..||..::..:.||....:.:| :||.|.||..|..:|.|.|.|.||.::: |.:..:|.|.
  Fly   319 NEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEY 383

Human   380 RDTGRYGFLLPESQIRATCEETFLAI 405
            ||.|||||:||..||...|||..:.:
  Fly   384 RDKGRYGFILPPVQIIPNCEELMVGM 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CPB1NP_001862.2 Propep_M14 29..103 CDD:280416 12/76 (16%)
M14_CPB 114..413 CDD:199852 116/302 (38%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 176..179 3/3 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 251..252 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 305..306 1/1 (100%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 12/79 (15%)
M14_CP_A-B_like 122..415 CDD:199844 114/293 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70429330
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3103
Isobase 1 0.950 0 Normalized mean entropy S1851
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T130174
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.