DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ecel1 and Nepl11

Sequence 1:NP_001264854.1 Gene:Ecel1 MGIID:1343461 Length:775 Species:Mus musculus
Sequence 2:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster

Alignment Length:720 Identity:147/721 (20%)
Similarity:248/721 (34%) Gaps:225/721 (31%)


Mouse   113 LSANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQNEERLRRLLARPTGGPGGAA 177
            |...||.|..||||||.:.|.     |:           |.:.|...:|.:.||...........
  Fly    35 LEPYLDTSKQPCQDFYGYVCS-----HS-----------ANLSETGRQRFQSLLKETDVAQLMDM 83

Mouse   178 QRKVRAFFRSCLDMREIERLGPRPMLEVIEDCGGW-----DLGGAADRPG-AARWDLNRLLYKAQ 236
            :.::..||:||...|.:|.|...   ::....|||     :...|:.|.. ..|| |..|.|   
  Fly    84 ELQLINFFKSCESGRGVEALKGS---QLYRQSGGWPSLEPNKVNASQRTNQTQRW-LGLLGY--- 141

Mouse   237 GVYSAAALFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEESEKILAAYRVFMQRLLRLL 301
             .:...|.:....|:..:::.|.|: :..||..  ..||               |.|.||:..:|
  Fly   142 -FHEVGAPYFFETSVTMQSNKRLVV-LQPDGTR--RNTL---------------RKFEQRVGEVL 187

Mouse   302 GADAVEQK-----AQEILQLEQRLANISVSEYDDLRRDVSSA-------------YNKVTLGQLQ 348
            .:..:||.     |.|:|.||:.            |||:..|             :.::..|...
  Fly   188 QSFGIEQSRAHVTALEVLSLERS------------RRDIVKADHVEDQVQFSYGNFKRIVFGNAS 240

Mouse   349 KIIPHLQWKWLLDQIFQEDF-----SEEEEVVLLATDYMQQVSQLIRSTPRRILHNYLVWRVVVV 408
            .|  .|.|    |..|::..     ...:.:|:.....:.:...|:::|....|.|: :|     
  Fly   241 LI--RLDW----DGYFRKLLGGKTPQASDTIVVKQLPRLVEYFALLQNTSMVRLLNW-IW----- 293

Mouse   409 LSEHLSSPFREALHELAKEMEGNDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQL 473
             :::|........|:|::...|:.....:.||   .|||        :.:.:.:|...||...||
  Fly   294 -TDYLMDIVDADCHQLSETYAGDLYAHVVQRV---TANR--------VELAQMYSELGKAYTDQL 346

Mouse   474 VEDIKYILGQRLEELDWMDAQTKAAARAKLQYMMVMVGYPDFLLKPEAVDKEYEFEVHEKTYFKN 538
            ...:            |:|..::.::|..|..:|...     |...|.:|..|            
  Fly   347 GGSV------------WIDEISRQSSRQFLGNIMHTT-----LNGDERLDAAY------------ 382

Mouse   539 ILNSI---RFSIQLSVKKIR-------------QEVDKSSWLLPPQALNAYYLPNKNQMVFPAGI 587
              :||   |.|:..:::|:|             |:|.:.:.:..|  :||:             :
  Fly   383 --HSILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQMFAP--VNAF-------------L 430

Mouse   588 LQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWWTETSYSHFLRKAECIVR 652
            .|..|..|     |||..:|......|..     .|...|:...  |.:..|...|....:|:  
  Fly   431 GQHNLSTP-----LNYLLLGEFFSRSLVA-----AGSSSRTQGA--WRSSDSERRFAIFQQCV-- 481

Mouse   653 LYDNFTVYNQRVNGKHTLGENIAD----MGGLKLAYYAYQKWV-REHGPEHPLHRL------KYT 706
                         ||.|   |..|    :...:.|..||.:|: .:.|....:..:      |.:
  Fly   482 -------------GKQT---NAIDLLLSLLAQRQALSAYGQWLATQAGLVERVDAVLAAGSSKMS 530

Mouse   707 HNQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHC-------PKDS 764
            ..:|||:.   :..:..||:...||  .|:.....:..|.:..:|.|   ||.|       |:|.
  Fly   531 LQRLFFVT---SLLVDCRSELGALQ--QDRKRQVTHATLRNSPEFLE---AFRCRPGDVLYPQDQ 587

Mouse   765 PMNPV 769
            ..||:
  Fly   588 RCNPL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ecel1NP_001264854.1 PepO 112..766 CDD:226118 145/716 (20%)
M13 121..773 CDD:189000 143/713 (20%)
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 141/706 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.