DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CPA3 and CG8539

Sequence 1:NP_001861.2 Gene:CPA3 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster

Alignment Length:355 Identity:93/356 (26%)
Similarity:168/356 (47%) Gaps:58/356 (16%)


Human    91 ILIHDLQE--EIEK------QFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGS 147
            |:::.|.|  |:.:      |.|            .|.:::.|:.:.:::...:...|:...:..
  Fly    14 IVVNQLSEAREVRRRRGLMLQLD------------NYLSYDGIMQYLDELALSHSNRVTLKDVAR 66

Human   148 TVEDNPL--YVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRM 210
            |.|:..|  .::..|:....::.||.|..:|:|||::||.....:::....:..|   :.||...
  Fly    67 TYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDY 128

Human   211 NFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASWN-SIPNTNDPCADNYRG 274
            :::|:|:.|.|||.:|....|.||..|:.| ...|.||:|||||...|| ..|...|||.:||.|
  Fly   129 DWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAG 192

Human   275 SAPESEKETKAVTNFIRSHLNEIK---VYITFHSYSQMLLFPYGYTSKLPPN---HEDLAK---- 329
            |:|.||.|.:.|.:.:.. |.|.|   :|::.|:.::.:.:|:.|.:....|   |:::.:    
  Fly   193 SSPFSEVEARTVRDIMHG-LVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVAD 256

Human   330 --VAKIGTDVLSTRYETRY--IYGPIESTIYPISGSSLDWAYDLGIKHTFAFEL----RDKGKFG 386
              :...||.:.:.:| .:|  .:|          |:|:|:|...|...:|.||:    ||..::.
  Fly   257 RILQSTGTFIKTWQY-AKYAGTFG----------GTSMDYALLAGFPLSFVFEMSGTGRDHVEYK 310

Human   387 FLLPESRIKPTCRETMLAVK-FIAKYILKH 415
            |..|...|:....|:...:| |..|.|.|:
  Fly   311 FFPPARDIRHLAEESWTGIKAFAEKTIEKY 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 4/13 (31%)
M14_CPB 114..413 CDD:199852 86/321 (27%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 84/313 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69376514
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.