DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CPA3 and CG17633

Sequence 1:NP_001861.2 Gene:CPA3 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster

Alignment Length:422 Identity:132/423 (31%)
Similarity:224/423 (53%) Gaps:29/423 (7%)


Human     9 LIATTLAIAP--------VRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMM 65
            |:...|||..        ||:|..::::|..::.||.:::|||..:::...:..| .|.|.|::.
  Fly     7 LLFALLAIVASASVSAERVRYDNYRMYKVNSENAKQLEVLKDLEGSSDSIMFLDG-VHLVGADIQ 70

Human    66 VDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGR----HSYAKYNNWEKIV 126
            :  .|:..:.......|.::::.||:...|:|:.:: :.|.|..|.||    :::|:|...:...
  Fly    71 I--IVAPHKVPDFLEILGKSEIKYELQSRDVQKSLD-EIDEKVAIKGRATTAYNWAQYYELDDTY 132

Human   127 AWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKI---GE--KNERRKAIFTDCGIHAREWVSPAFC 186
            ||.:.:....|.:|:.|:.|.|.:...:..:||   ||  ..:.:..||.:.|||||||::||..
  Fly   133 AWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAREWIAPAAA 197

Human   187 QWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLN 251
            .:.:.|...:...|  :.:|.:...:|:||..|.|||:::.|.||:|||.|:  ....|.|.|.|
  Fly   198 TFIINQLLTSEVEN--IKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRT--PYGSCFGADPN 258

Human   252 RNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGY 316
            ||:...||.:..::..|:|.|.|.:..||.||.:::.||.....::::|::.|:|||.||:|||:
  Fly   259 RNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQYLLYPYGH 323

Human   317 TSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDL-GIKHTFAFELR 380
            ||.||.|..|..||.......::.||.|.|..|.|...|||.:|:|:||||.. .::..|.:|||
  Fly   324 TSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYELR 388

Human   381 DKGK---FGFLLPESRIKPTCRETMLAVKFIA 409
            ....   .||.||..:|.|...|.:.::..:|
  Fly   389 PSSTSYLTGFKLPAEQIVPASEELLDSIVAMA 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 16/74 (22%)
M14_CPB 114..413 CDD:199852 104/306 (34%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 119/375 (32%)
Propep_M14 34..105 CDD:280416 16/75 (21%)
M14_CP_A-B_like 125..423 CDD:199844 103/301 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69509495
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T130174
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.