DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CPA2 and CG18585

Sequence 1:NP_001860.2 Gene:CPA2 HGNCID:2297 Length:419 Species:Homo sapiens
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:402 Identity:131/403 (33%)
Similarity:223/403 (55%) Gaps:37/403 (9%)


Human    38 IKNLLQLEAQEHL-----QLDFWKS----------PTTPGETAHVRVPFVNVQAVKVFLESQGIA 87
            |:|.:||.|.|.:     :.:.||.          ..:|||..|          .:..|:...|:
  Fly    37 IQNKIQLAAIEKIGELTKKYNIWKEYDERSRQIDIMVSPGELNH----------FQELLKFNNIS 91

Human    88 YSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSS 152
            ..:|||:||..:|:|......:     |..|.:..|:.||||...:|.::..:|.:..:..:|.|
  Fly    92 SELMIENVQERIDE
EQVTPTAD-----SATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKS 151

Human   153 FENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDALDIFL 217
            :|.|.:..:|.|.....|.|::::.||||||:|.|:|.|..|::::  .:|..:.|:.|..|..:
  Fly   152 YEGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFINQLLT--SEDADVRSLADNYDWHI 214

Human   218 LPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDA-GFGGPGASSNPCSDSYHGPSAN 281
            :||.|.||:.:|..|:|||||||...:.:.|:|.|.|||:|: .....|||.||||:::.|.:..
  Fly   215 IPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPE 279

Human   282 SEVEVKSIVDFI-KSHGKVKAFITLHSYSQLLMFPYGYKCTKL-DDFDELSEVAQKAAQSLRSL- 343
            ||.|.|::|::: |...::..:|:.|||.|.|:.|||:...:. ::::::..:.:..|.::.:| 
  Fly   280 SEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALP 344

Human   344 HGTKYKVGPICSVIYQASGGSIDWSY-DYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGL 407
            :||.|:.|....|:|.|:|.|:||.: :.|.|..:..|.||.|||||:||..||:|..||..:|:
  Fly   345 YGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQIIPNCEELMVGM 409

Human   408 KAIMEHVRDHPY 419
            .|::|..::..|
  Fly   410 LALIEKTKELGY 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CPA2NP_001860.2 Propep_M14 29..101 CDD:280416 20/78 (26%)
M14_CPA 118..417 CDD:133081 108/304 (36%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 179..182 3/3 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 254..255 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 307..308 1/1 (100%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 20/78 (26%)
M14_CP_A-B_like 122..415 CDD:199844 107/295 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71088612
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 1 1.000 H37541
Inparanoid 1 1.050 257 1.000 Inparanoid score I3103
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.