DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CPA1 and CG3097

Sequence 1:NP_001859.1 Gene:CPA1 HGNCID:2296 Length:419 Species:Homo sapiens
Sequence 2:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster

Alignment Length:402 Identity:127/403 (32%)
Similarity:217/403 (54%) Gaps:27/403 (7%)


Human    32 DEAQVQKVKELEDL--------EHLQLDF----WRGPAHPGSPIDVRVPFPSIQAVKIFLESHGI 84
            ||||:.::..:.:.        :.|:..|    |:   .....:|:.:....::|.:.||.:|.:
  Fly    42 DEAQLWRIYNISEAMQKRVPVGQMLEQKFGGNIWK---ENSKFLDISIARDQLKAARSFLSAHRL 103

Human    85 SYETMIEDVQSLLDEE-----QEQMFAF--RSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHL 142
            ..:.:..::||::|||     |...|..  |::..:..:.::..||.||.||.|:..:..:.|::
  Fly   104 DPQILSHNIQSMIDEELLEGIQSSSFGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNI 168

Human   143 VSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFT 207
            |....||.|.|||.:.||:.|....:...:|||.|||:|||::.|:..:...::..|:....|. 
  Fly   169 VRLYTIGQTAEGRDLKVLRISENPRENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAH- 232

Human   208 AILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCS 272
              :..|..::..|.||||:.::.:|||:|||.||.:..:.|.|||.|||:|.|:...|:|:||||
  Fly   233 --IRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCS 295

Human   273 ETYHGKFANSEVEVKSIVDFV-KDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAA 336
            :||.|....||.|.:::.:|: |...|::::::.|||.|:::||:.||...|.|...|.::|..|
  Fly   296 DTYRGSAPASERETRAVAEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLA 360

Human   337 VTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQ-GIKYSFTFELRDTGRYGFLLPASQIIPTA 400
            ...:....||.:......:.:..|.|.:.||:.:. |:||.:|.||||.|.|||:||...|..||
  Fly   361 AERILQKTGTSYRAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTA 425

Human   401 KETWLALLTIME 412
            .|.|..:.|:.:
  Fly   426 LEGWTVVETVAQ 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CPA1NP_001859.1 Propep_M14 26..100 CDD:308061 16/80 (20%)
M14_CPA 117..417 CDD:133081 107/299 (36%)
Substrate binding. {ECO:0000244|PDB:2V77, ECO:0000269|PubMed:18566513} 179..182 2/3 (67%)
Substrate binding. {ECO:0000244|PDB:2V77, ECO:0000269|PubMed:18566513} 254..255 1/1 (100%)
Substrate binding. {ECO:0000244|PDB:2V77, ECO:0000269|PubMed:18566513} 307..308 1/1 (100%)
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 11/57 (19%)
M14_CP_A-B_like 148..439 CDD:199844 107/294 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69906995
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T130287
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.651 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.