DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dgcr2 and arr

Sequence 1:NP_034178.2 Gene:Dgcr2 MGIID:892866 Length:549 Species:Mus musculus
Sequence 2:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster

Alignment Length:556 Identity:93/557 (17%)
Similarity:140/557 (25%) Gaps:259/557 (46%)


Mouse    30 CNPGQFACHGGTI-------QCIPLPWQCDGWPTCEDKSDEADCPEVTGEARPYGKETVDLRQGR 87
            |.|..|.|.....       .|||..|:|||...|.|||||..||....:               
  Fly  1319 CGPDHFTCAAPVSGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRAD--------------- 1368

Mouse    88 ARGGDPTHFHTVNVAQPVRFSSFLGKCPSGWHHYEGTASCYRVYLSGENYWDAAQTCQRVNGSLA 152
                              :||...|:|.......:||.:|                   .||   
  Fly  1369 ------------------QFSCQSGECIDKSLVCDGTTNC-------------------ANG--- 1393

Mouse   153 TFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNHSLEGRWEVAFKGSPEVFLPPD 217
                                                                             
  Fly  1394 ----------------------------------------------------------------- 1393

Mouse   218 PIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCSEKSSFLCKRSQTCVDIKDNVVDEGF 282
                                        ||    .|:.|.....|.|..::.|:.          
  Fly  1394 ----------------------------HD----EADCCKRPGEFQCPINKLCIS---------- 1416

Mouse   283 YFTPKGDDPCLSCTCHRGEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGSSLFDSMASGM 347
                                   .|.||:..:.|.....:..:    :||....:...|..|..:
  Fly  1417 -----------------------AALLCDGWENCADGADESSD----ICLQRRMAPATDKRAFMI 1454

Mouse   348 RLVVSCISSFLILSLLLFMVHRLRQRRRE----------------------RIESLIGA-NLHHF 389
            .:..:.|:.|.|:.||.|...|:.:.|.|                      :|.|:..| .:...
  Fly  1455 LIGATMITIFSIVYLLQFCRTRIGKSRTEPKDDQATDPLSPSTLSKSQRVSKIASVADAVRMSTL 1519

Mouse   390 NLGRRIPGFDYGP-DGFGTGLTPLHLSDDGEGGTFHFHDPPP--------PYTAYKYPDMDQPDD 445
            |....:..:|... .|..:..|      :|.....:..:|||        ||..||.  ::|| .
  Fly  1520 NSRNSMNSYDRNHITGASSSTT------NGSSMVAYPINPPPSPATRSRRPYRHYKI--INQP-P 1575

Mouse   446 PPPPYEASI--NPDSVFYDPADDD-----AFEPVEASLPAPRDGGIEGALPRHLDQPLPPAETSL 503
            ||.|....|  ..||.:...::.:     |.:...:|..|....|.:       .:|.||..|..
  Fly  1576 PPTPCSTDICDESDSNYTSKSNSNNSNGGATKHSSSSAAACLQYGYD-------SEPYPPPPTPR 1633

Mouse   504 ----ADLEDSTDSSSALLVPPDPAQSGSTPATEAPP 535
                :|:....:||    .||.|:...||..:..||
  Fly  1634 SHYHSDVRIVPESS----CPPSPSSRSSTYFSPLPP 1665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dgcr2NP_034178.2 LDLa 30..66 CDD:238060 17/43 (40%)
CLECT_DGCR2_like 114..266 CDD:153069 12/152 (8%)
VWC 270..328 CDD:214564 5/58 (9%)
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320
NHL repeat 428..476 CDD:271320
LY 472..511 CDD:214531
NHL repeat 477..503 CDD:271320
Ldl_recept_b 534..573 CDD:278487
LY 558..599 CDD:214531
LY 600..641 CDD:214531
FXa_inhibition 668..703 CDD:291342
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060 17/43 (40%)
LDLa 1365..1399 CDD:238060 12/186 (6%)
LDLa 1399..1433 CDD:197566 8/67 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.