DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dctn1 and DCTN1-p150

Sequence 1:NP_031861.2 Gene:Dctn1 MGIID:107745 Length:1281 Species:Mus musculus
Sequence 2:NP_524061.1 Gene:DCTN1-p150 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster

Alignment Length:1287 Identity:428/1288 (33%)
Similarity:695/1288 (54%) Gaps:110/1288 (9%)


Mouse    23 SARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGI 87
            |.:.|:||:|||:.||...|||||||.|.||.||||||:|||.||||.|:::|::||.|||..|:
  Fly     2 SEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCGM 66

Mouse    88 FVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLRGLKPKKAPTARKTTTRRPKP 152
            |||.:|:::.| .|..:.....|.|.:.....:...|...:|:......:::....:|.......
  Fly    67 FVRPTQLRLLE-AAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLTTSLS 130

Mouse   153 TRPASTGVAGPSSSLGPSGS----------------ASAGELSSSEPS----------------- 184
            .|.||:...||..||.|..|                ||.|..::|..|                 
  Fly   131 ERTASSSSIGPRKSLAPQNSKDKESPSTSLAEGAPAASGGNGAASHASSKRASFVETGFLEILKP 195

Mouse   185 --TPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKE 247
              ||:| ||.:|....|:.:.......|....|....|:||:.||.||||||:.:|:|||.:|:|
  Fly   196 QFTPSQ-PLRSPSFTMPSNSGAEDKVALLEAQKTSAELQAQLADLTEKLETLKQRRNEDKERLRE 259

Mouse   248 LEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKE 312
            .:|.|||.||:||:::|:...||.||:.|..|::|||:|:||||::.:||||.||.:||.|||||
  Fly   260 FDKMKIQFEQLQEFRTKIMGAQASLQKELLRAKQEAKDAIEAKEQHAQEMADLADNVEMITLDKE 324

Mouse   313 MAEERAESLQQEVEALKERVDELTTDLEILKAEIEEK-----------GSDGAASSYQLKQLEEQ 366
            ||||:|::||.|:|:.|||::||..|||:|::|::.|           |.....|:|:.||||:|
  Fly   325 MAEEKADTLQLELESSKERIEELEVDLELLRSEMQNKAESAIGNISGGGDSPGLSTYEFKQLEQQ 389

Mouse   367 NARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVD 431
            |.|||:.|||:||||:.:|.:..||.|.:|.|..|:..:.:.:|:|..::.:.|:.:.:|:||||
  Fly   390 NIRLKETLVRLRDLSAHDKHDIQKLSKELEMKRSEVTELERTKEKLSAKIDELEAIVADLQEQVD 454

Mouse   432 AALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARV 496
            ||||||||||.|.::.:.||:||:.|.|.:..|||:.|::::|.|:..|.||:|||:||:|....
  Fly   455 AALGAEEMVEQLAEKKMELEDKVKLLEEEIAQLEALEEVHEQLVESNHELELDLREELDLANGAK 519

Mouse   497 REAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPP-----PETFDFK 556
            :|..:..:||.||:.|..|||.|:|:|...|.|...||.::..::.:...|.|     .||.|:|
  Fly   520 KEVLRERDAAIETIYDRDQTIVKFRELVQKLNDQLTELRDRNSSNEKESLQDPSLKMVTETIDYK 584

Mouse   557 IKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAEL 621
            ..|||:||:.:||:::|||:|::|||.|:.:||||||:||:..|||||.:||:||:.|::.|.::
  Fly   585 QMFAESKAYTRAIDVQLRQIELSQANEHVQMLTAFMPESFMSRGGDHDSILVILLISRIVFKCDI 649

Mouse   622 IRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVG 686
            :..|.:|:|...:..:.....:|.|.:|.:|...|::.:..||..||:..:.|:.|..|...:.|
  Fly   650 VVSQTRERFPPVDAITREAVTQGHAVQQYAFKCRLLHYVHSLQCALHQILYGLNSCQPDTLLRAG 714

Mouse   687 SLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLA-EQPEDSTMQLADHI 750
            |..|||.|.|:.:|.:||||..:||||....:.:.|.:.::..:.|:.|| ||..:....:.|.:
  Fly   715 SSLPEMVAQEKIVDGIIELLKSNQLDENSTTDNIEKCVAFFNAMNSVLLAGEQLLNEIQMIRDCV 779

Mouse   751 KFTQSALDCMGVEVGRLRAFLQGGQEATDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPA 815
            ....:|.:.:..:....:..:|.....:|..||::.|..:....||..|.|:||:| :|...|.:
  Fly   780 ASLGAACESILSDTAIAKVIIQEAGATSDSVLLIQFLNENMESVRQQVKLIKRRLP-SDQHVIKS 843

Mouse   816 ALAFGSQVSDTLLDCRKHLTWVVAVL-----QEVAAAAAQLIAPLAENEGLPVAALEELAFKASE 875
            .|:  ....:.:....::::.:::.:     |.:||..:.:.:..|....||......|...:.|
  Fly   844 GLS--QHKVEAMRGLAQNISRIMSAMHQATKQSLAAIVSTIESDNAAEHTLPQEKYWALLTASCE 906

Mouse   876 QIYGSPSSSPYECLRQSCTILISTMNKLATAMQEGEYD----------AERPPSKPPPVELRAAA 930
            :||......|.:..:.......|.:..:|..:.:.|||          .::..:...|:..||..
  Fly   907 RIYEQDDRGPTQNFKTLLAQANSDLQLIAQHLLDKEYDIISAANNASNQQKSGAHSTPITQRAQL 971

Mouse   931 LRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQ 995
            ::.::.....|...||:||..:|:||.:.|:|..||||..:|..|.||||.....:.:..::|.:
  Fly   972 IKKQLEQKNVLAATLENREADVKQLKVAAKMKQNELSEMQIRKDLAEKKLSVLQNEYEHAVDKWK 1036

Mouse   996 TRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAEL--KQRLNSQSKRTIEGLRGPPPSGIAT 1058
            .:.:||...|:.|||:||||||.||:|||.||:||::|  |.:|||.:.:...|.....|..|: 
  Fly  1037 QKYEETSLQLQLKEKEFEETMDHLQSDIDALESEKSDLRDKLKLNSTTGKVQPGSESHSPHNIS- 1100

Mouse  1059 LVSGIAGEEPQRGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASL 1123
             :||.....|........||..        .:|::.:::..::...:|.:::...|:...|:|.|
  Fly  1101 -LSGNTSTAPGISNVSYSAPAG--------TAPVVAEEVELLKNAFNQERNQRLRLQAQDMRAKL 1156

Mouse  1124 AALPPLHVAKLSLPPHEGPGGNLVAGALYRKTSQLLEKLNQLSTHTHVVDI--TRSSPAAKS--- 1183
            :...||||.:    |.:            ::.:.|..:|.::. |..|:.:  .||..:..|   
  Fly  1157 SQFEPLHVPQ----PQD------------QRITALESELTRMK-HAWVLSLLQVRSQDSVNSGTR 1204

Mouse  1184 ---PSAQLMEQVAQLK-SLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPS 1231
               .:.|...|...|| .:|....:|..::|.|.:.::|.......||:||:
  Fly  1205 IDAVALQRRNQPVPLKGEISSKASQLASDILTEYLQRKPHRATHGQFASFPT 1256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dctn1NP_031861.2 CAP_GLY 30..94 CDD:279625 41/64 (64%)
CCDC144C 227..547 CDD:291576 151/331 (46%)
PCRF 246..>342 CDD:305100 54/96 (56%)
CASP_C 314..>455 CDD:285395 68/152 (45%)
Dynactin 525..805 CDD:289240 94/286 (33%)
Interaction with HPS6. {ECO:0000269|PubMed:25189619} 911..1281 92/343 (27%)
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 42/66 (64%)
Dynactin 553..834 CDD:289240 92/281 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316131761
eggNOG 1 0.900 E1_COG5244
Hieranoid 1 1.000
Homologene 1 1.000 H3011
Inparanoid 1 1.050 671 1.000 Inparanoid score I730
Isobase 1 0.950 0.919607 Normalized mean entropy S4264
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003576
OrthoInspector 1 1.000 T1082643
orthoMCL 1 0.900 OOG5_130174
Panther 1 1.100 LDO PTHR18916
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1398
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.