DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Slc6a3 and CG8850

Sequence 1:NP_034150.1 Gene:Slc6a3 MGIID:94862 Length:619 Species:Mus musculus
Sequence 2:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster

Alignment Length:569 Identity:194/570 (34%)
Similarity:304/570 (53%) Gaps:17/570 (3%)


Mouse    33 LVKEQNGVQLTNSTLINPPQTPVEVQERETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGA 97
            ::....|.:||    ||.........:|:.||:.::||.|.|..:|.|.||||||::..:|||||
  Fly    34 VIYSAEGEELT----INCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGA 94

Mouse    98 FLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAW 162
            ||:||::.:::.|.|::|:|:.:|||:..|....:.:.|:::|:.:..:..:.....:|..|:|.
  Fly    95 FLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALATTYYACIMAL 159

Mouse   163 ALHYFFSSFTMDLPWIHCNNTWNSPNC--SDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQ 225
            .:.|..:||:..|||.:|...|.. :|  :.|.::|.|     :...|.:.|..:|.:.||...:
  Fly   160 TIRYLVASFSEVLPWTYCLVEWGK-SCVATGATAANDS-----SIVQGVSSAELFFTQTVLREPE 218

Mouse   226 SRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAM 290
            |...:.||.|.|.|..||:...|::...|.||:::|||..:..|..|||::..||:|.||||||.
  Fly   219 SLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAW 283

Mouse   291 DGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLT 355
            .||..:|...:.:|....||..|.||:.|||.:.||.|:.::|:|.|..|.::|.||.|:|:|||
  Fly   284 QGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLT 348

Mouse   356 SFSSGFVVFSFLGYMAQKHNV-PIRDVATDGPGLIFIIYPEAIATLP-LSSAWAAVFFLMLLTLG 418
            |..:|.::|..||.:|.:.|. .|..|...|.||.||.||||||... |...:|.:||.|||.||
  Fly   349 SILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLG 413

Mouse   419 IDSAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSI 483
            |.|.:|...:|:..:.|.|  .|....|..:...:..||..|..:|.||.:|..|:|.:......
  Fly   414 IGSNIGMASAVVNVVKDRF--THLPHWLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIA 476

Mouse   484 LFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIVTFRPPHYG 548
            |...:.|.:.|.|.|||::...||:.|...:.:.|||:||.:|:|..:..|:|..:.::.|..|.
  Fly   477 LVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYR 541

Mouse   549 AYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPG-SFREKLAYAITP 596
            ...:|......||||....:..:|.:|.......|| :|..|...|:.|
  Fly   542 GVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQP 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slc6a3NP_034150.1 SLC5-6-like_sbd 60..613 CDD:294310 189/543 (35%)
Interaction with TGFB1I1. {ECO:0000250} 560..589 9/30 (30%)
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 173/482 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106791762
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.