DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4b1 and Cyp6a23

Sequence 1:NP_031849.1 Gene:Cyp4b1 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster

Alignment Length:541 Identity:127/542 (23%)
Similarity:226/542 (42%) Gaps:100/542 (18%)


Mouse    22 LMVTVLKLL--SLLFRRQKLARALDSF------PGPPKHWLFGHALEIQKTGGLDKVVTWTEQFP 78
            |::|::.||  .|||    :||....:      |....|.::|:..:            |.::..
  Fly     3 LLLTLIALLVSLLLF----MARRRHGYWQRRGIPHDVPHPIYGNMKD------------WPKKRH 51

Mouse    79 YAHPLWLGQFIVFLNIYEPDYAKAVYSRGDPKAAYVYDF-------------------FLQWIGK 124
            .|        ::|.:.| ..|.::||    |.|.:.:.|                   |..:..:
  Fly    52 IA--------MIFRDYY-TKYKRSVY----PFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENR 103

Mouse   125 G-------------LLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKAS--E 174
            |             |..:||.||...|..|||.|....:|....|..:....|...:..|.:  |
  Fly   104 GIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGE 168

Mouse   175 NKSFDIFCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWL 239
            .:..:|...|.....|.:..|.||...:.| .:.|:.::.:....:: ::|.....   ||:.:.
  Fly   169 GQVLEIVDLVARYTADVIGNCAFGLNCNSL-QNPNAEFVTIGKRAII-ERRYGGLL---DFLIFG 228

Mouse   240 TPHGRRFLRA---CQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILL-------GARD 294
            .|...|.||.   .|...|....::|      .....:.:..|:|| ||:|.|:       ....
  Fly   229 FPKLSRRLRLKLNVQDVEDFYTSIVR------NTIDYRLRTNEKRH-DFMDSLIEMYEKEQAGNT 286

Mouse   295 ESGIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDS-FQWD 358
            |.|  ||..::.|:...|...|.:|:::.:.:.||.:||....|.:.|.|:..:|...:: |.::
  Fly   287 EDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYE 349

Mouse   359 DLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPA-GSLISLHIYALHRNSAVWPDP 422
            .:.:|.||...:.|..|.||.:..:.|......:..|.:...| |:.:.:....:|.:..::|:|
  Fly   350 GIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEP 414

Mouse   423 EVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFS-PDPSKIPIK 486
            |.|.|.||:.|.:..|....::||..|||||||.:|.:.:..|..|..:..::|| ...::||:|
  Fly   415 EKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMK 479

Mouse   487 --VPQLILRSKNGIHLYLKPL 505
              |..::|.::|||||.::.|
  Fly   480 FVVKSILLSAENGIHLKVEKL 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 116/502 (23%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 115/498 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.