DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4a14 and Cyp4d20

Sequence 1:NP_031848.1 Gene:Cyp4a14 MGIID:1096550 Length:507 Species:Mus musculus
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:521 Identity:167/522 (32%)
Similarity:267/522 (51%) Gaps:55/522 (11%)


Mouse    21 WAFLLSLFLVLFKAVQFYLRRQWLLK-TLQHFPCMPSHWLWGHHLKDKEL--QQILIWV-EKFPS 81
            |..|::..|:|.....|..:||.:|. .....|...|..:.|..|:...|  :.|:.|| |||..
  Fly     2 WLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWVGEKFDK 66

Mouse    82 ACLQCLSGSNIRV------LLYDPD--YVKVVLGRSDPKASG-IYQFFAPWIGYGLLLLNGKKWF 137
                  .|...|.      |:|..|  |.:.:|..:.....| :|::..|::..|||:..|:||.
  Fly    67 ------YGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVSTGRKWH 125

Mouse   138 QHRRMLTPAFHYDILKPYVKIMADSVNIMLDKWEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSYQ 202
            ..|::.|.|||:.:|:.||:||....::|:|...|:......:::...|||..||.:.:.|...|
  Fly   126 ARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQ 190

Mouse   203 GSVQLDENSKLYTKAVEDLNNLTFFRLRNAFYKYNIIYNMSSDGRLSHHA----CQIAHEHTDGV 263
            .:.|.|.:.. |.||::.:..:...|:.....:||.::.:::.  |.|..    .::.|:.||.|
  Fly   191 VNAQNDPDFP-YIKALKSVVYIQPDRMFRFSRRYNWLFPLAAP--LLHRQLLSDIRVMHDFTDKV 252

Mouse   264 IKMRKSQLQNEEELQKAR----------------KKRHLDFLDILLFARMEDRNSLSDEDLRAEV 312
            |..|:      |.:::|:                .|..:..|||||.:.:.:: .|||.|:|.||
  Fly   253 ISERR------ETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQ-PLSDADIREEV 310

Mouse   313 DTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQSILGDGTS--VTWDHLGQMPYTTMCIKE 375
            |||||||.|||:||:|...||:|.|||.|||..||:|.:||...|  ||...|..:.|....|||
  Fly   311 DTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKE 375

Mouse   376 ALRLYPPVISVSRELSSPVTFPDGRSIPKGITATISIYGLHHNPRFWPNPKVFDPSRFAPD--SS 438
            .:||||||.::.|.....:...| ::||...:..:.:|..|.:..::|:|..|.|.||..|  ..
  Fly   376 TMRLYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQG 439

Mouse   439 HHSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPIARLVLKSKNGIHLCL 503
            |::.||:|||.|.:||||::||:.|:||.::..|..:||||....:. |:...:|:|.:||::.|
  Fly   440 HNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELK-PMLNFILRSASGINVGL 503

Mouse   504 K 504
            :
  Fly   504 R 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 158/485 (33%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 154/477 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114332298
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.