DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4a12b and Cyp6a23

Sequence 1:NP_758510.2 Gene:Cyp4a12b MGIID:3611747 Length:508 Species:Mus musculus
Sequence 2:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster

Alignment Length:560 Identity:130/561 (23%)
Similarity:233/561 (42%) Gaps:140/561 (25%)


Mouse    21 VASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHKILKD--------QDLQDILTRI 77
            :|.::||||.:.:....|..|:.:       |....|.::|:  :||        ...:|..|:.
  Fly     8 IALLVSLLLFMARRRHGYWQRRGI-------PHDVPHPIYGN--MKDWPKKRHIAMIFRDYYTKY 63

Mouse    78 KN--FPSACPQWLWGSKVRIQVYDPDYMKLILGR---------------SDPKAHGSYRFLAPWI 125
            |.  :|.|...:.:.....|.  |.:.:|.:|.:               .||            :
  Fly    64 KRSVYPFAGFYFFFTRSAVIT--DLELVKRVLIKDFNHFENRGIFYNEIDDP------------L 114

Mouse   126 GRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQI------VGQDSTLEIF 184
            ...|..::||.|...|..|||.|....:|....|:..    :.::.|:|      .|:...|||.
  Fly   115 SATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVK----VGEEMEKIFSAKTTTGEGQVLEIV 175

Mouse   185 QHITLMTLDTIMKCAFS-HEGSVQ--------------LDRKY--------------------KS 214
            ..:...|.|.|..|||. :..|:|              ::|:|                    |.
  Fly   176 DLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKL 240

Mouse   215 YIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAHDHTDQVIKSRRSQLQDEEELE 279
            .:|.|||    |:..:    .:|.|.||:.:|        :..||..|.:|     ::.::|:. 
  Fly   241 NVQDVED----FYTSI----VRNTIDYRLRTN--------EKRHDFMDSLI-----EMYEKEQA- 283

Mouse   280 KLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQR 344
                            ...|:|  ||..::.|:...|...|.:|:::.:.:..|.||.:.:.|.:
  Fly   284 ----------------GNTEDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQ 330

Mouse   345 CRKEIQSLLG-DGASITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGR-SLPKGI 407
            .|.||.::|. .....|:..:.:|.|....:.|.||.||.:..::|...:..:..|.: .:.||.
  Fly   331 LRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGT 395

Mouse   408 HVMLSFYGLHHNPTVWPNPEVFDPSRFAPG--SSRHSHSFLPFSGGARNCIGKQFAMNELKVAVA 470
            .|::...|:|::|.::|.||.|.|.||...  ::|.|.::|||..|.|||||.:|.:.:..|.:|
  Fly   396 TVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLA 460

Mouse   471 LTLLRFEL-LPDPTRVPIP--IPRIVLKSKNGIHLHLKKL 507
            ..:..::. :...|::|:.  :..|:|.::|||||.::||
  Fly   461 YLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKL 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4a12bNP_758510.2 p450 52..502 CDD:278495 120/523 (23%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 119/519 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.