DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp3a13 and Cyp4d20

Sequence 1:NP_031845.1 Gene:Cyp3a13 MGIID:88610 Length:503 Species:Mus musculus
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:510 Identity:143/511 (28%)
Similarity:245/511 (48%) Gaps:69/511 (14%)


Mouse    12 WMLLATSLVLLYL---YGTHSHGI--FKKLGIPGPKPLPFLGTILAYQKGFWECDIQC------- 64
            |:.|.|..::|.|   :|.....:  |:|..||||..:|.||           |.:|.       
  Fly     2 WLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILG-----------CGLQALHLGAEN 55

Mouse    65 --------HKKYGKMWGLYDGRQPVLAITDPDIIKTVL----VKECYSTFTNRRRFGPVGILKKA 117
                    ..||||.:..:...:.::...|....:|:|    :.|....:...|.|     |...
  Fly    56 IIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPF-----LNDG 115

Mouse   118 ISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQGLGEGK-PTSMKDIFGAYSM 181
            :.:|...:|...|.:.:..|....|:....|:::.:.|:|.|:|: :.:|| ...|.......::
  Fly   116 LLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRK-VADGKTAVDMLKYVSLAAL 179

Mouse   182 DVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVT----LFPFLTPVF------DAL 236
            ||||..:.||.:::.|:|..|:::.:|.::.... |.:|....    |||...|:.      |..
  Fly   180 DVITEAAMGVQVNAQNDPDFPYIKALKSVVYIQP-DRMFRFSRRYNWLFPLAAPLLHRQLLSDIR 243

Mouse   237 NVSLFPRDVISFFTTSVERMKEN------RMKEKE---KQRVDFLQLMINSQNYKTKESHKALSD 292
            .:..|...|||....:|.|.|.:      .:.:.|   |.::..|.:::.|     ..:::.|||
  Fly   244 VMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQS-----SINNQPLSD 303

Mouse   293 VEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAAL-PN-KAPATYDTLLQMEY 355
            .:|..:...|:|.|.:||||.:|.|||.:|.||:||:::.:|:...| |: .||.|...|..::|
  Fly   304 ADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKY 368

Mouse   356 LDMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFS 420
            ||.|:.||:||||....:.|..:.::||....||..|.:.:..:..|:|..|:|:|..||||||.
  Fly   369 LDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFL 433

Mouse   421 KKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPL 475
            :..:...|.:.|:||.:||:||||.:||::.|||.:.:||:.:.:.|..|...|:
  Fly   434 EDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPM 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp3a13NP_031845.1 p450 39..493 CDD:278495 134/479 (28%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 134/479 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.