DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp3a11 and Cyp4d20

Sequence 1:NP_031844.1 Gene:Cyp3a11 MGIID:88609 Length:504 Species:Mus musculus
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:540 Identity:135/541 (25%)
Similarity:262/541 (48%) Gaps:93/541 (17%)


Mouse    12 WVLL---AISLVLLYRYGTRKHEL--FKKQGIPGPKPLPFLGTVLN-YYKGL-----W---KFDM 62
            |:.|   |:.|:|.:.:|.::..:  |:|..||||..:|.||..|. .:.|.     |   ||| 
  Fly     2 WLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWVGEKFD- 65

Mouse    63 ECYKKYGKTWGLFDGQTPLLAVTDPETIKNVL----VKECFSVFTNRRDFGPVGIMSKAISISKD 123
                |||||:..:.....|:...|.:..:.:|    :.|...::...|.|     ::..:.:|..
  Fly    66 ----KYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPF-----LNDGLLVSTG 121

Mouse   124 DEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTS 188
            .:|...|.:.:..|....|:....:::::..::|..||:.|.....|.|...:...::||||..:
  Fly   122 RKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAA 186

Mouse   189 FGVNVDSLNNPEDPFVEKAKKLL------------RFDFFDPLLFSVVLFPFLTPVY--EMLNIC 239
            .||.|::.|:|:.|:::..|.::            |:::         |||...|:.  ::|:  
  Fly   187 MGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNW---------LFPLAAPLLHRQLLS-- 240

Mouse   240 MFPKDSIEFFKKFVDRMKESRLDSKQKHRVD--------------------FLQLMMNSHNNSKD 284
                 .|.....|.|::...|.::.::.:.|                    .|.:::.|      
  Fly   241 -----DIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQS------ 294

Mouse   285 KVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEAL-PN-KAPPT 347
            .::::.|||.:|..:...|:|.|.:||||.:|..|:::|.||::|:::.:|:...| |: .||.|
  Fly   295 SINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVT 359

Mouse   348 YDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEP 412
            ...:.:::|||.|:.||:||||....:.|..:|::|:....||..:::.:..|..|.|..::.:|
  Fly   360 QAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDP 424

Mouse   413 EEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIP-- 475
            ..|:||||.::.:...:.:.|:||..||:||:|.:||::.||:.::|:::.:...|..|...|  
  Fly   425 LSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPML 489

Mouse   476 --LKLSRQGL---LQPEKPI 490
              :..|..|:   |:|.|.:
  Fly   490 NFILRSASGINVGLRPRKAL 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp3a11NP_031844.1 p450 39..494 CDD:278495 126/509 (25%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 121/491 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.