DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp2j6 and Cyp303a1

Sequence 1:NP_034138.3 Gene:Cyp2j6 MGIID:1270148 Length:501 Species:Mus musculus
Sequence 2:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster

Alignment Length:467 Identity:135/468 (29%)
Similarity:236/468 (50%) Gaps:38/468 (8%)


Mouse    30 LLADYFKN-RRPKNYPPGPWGLPFVGNIFQLD-----FGQPHLSIQPLVKKYGN---IFSLNLGD 85
            |||..|.. |:||.:||||...|.||:..|:.     .|.....|....::|.|   .:.|.:|.
  Fly    13 LLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGK 77

Mouse    86 ITSVVITGLPLIKEALTQMEQNIMNRPLSVMQ--ERISNKNGLIFSSGQIWKEQRRFALMTLRNF 148
            ...|:......|.|.:|  .::|..||..:..  ...:::.|::.:.|::|.|||||.|..|:||
  Fly    78 DKVVIAYTNDAISEMMT--NEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNF 140

Mouse   149 GLGKKSLEERMQEEASHLVEAIREE----EGKP--FNPHFSINNAVSNIICSVTFGERFDYHDSR 207
            |..:..:.:.:..||:.|::.::::    .||.  ...|...:..|.|.:..:..|.|::.....
  Fly   141 GFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPE 205

Mouse   208 FQEMLRLLDEVMYLETTMISQLYNIFPWIMKYIPG---------SHQKVFRNWEKLKLFVSCMID 263
            ..::|....| ::....|:..|::.||.:....|.         ||:.::       .|:|..|:
  Fly   206 ITQLLETFFE-LFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLY-------TFMSKEIE 262

Mouse   264 DHRKDW-NPDEPRDFIDAFLKEMTKYPEKTTSFNEENLICSTLDLFFAGTETTSTTLRWALLYMA 327
            .||..: |.|||||.:|::|:...:..::...|::::|:...||:|.||:|||:.:|.:..:::.
  Fly   263 LHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLV 327

Mouse   328 LYPEVQEKVQAEIDRVIGQKRAARLA-DRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNG 391
            |.||:||:...||..|:|.:|....: ||..:||..|:..|..||..:....:|.....||.|:|
  Fly   328 LQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSG 392

Mouse   392 FHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSE 456
            :.:||.|||:.....:..:|.::..|:.|||:.:|.:|..|..|:|.||..|:..|:|:.|.|..
  Fly   393 YEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPEAFNPFGFGRHRCMGDLLGRQN 457

Mouse   457 LFIFFTSLMQKF 468
            ||:|.|:::|.|
  Fly   458 LFMFTTTVLQNF 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp2j6NP_034138.3 p450 44..496 CDD:278495 128/453 (28%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 128/453 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.