DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp2b10 and Cyp303a1

Sequence 1:NP_034129.1 Gene:Cyp2b10 MGIID:88598 Length:491 Species:Mus musculus
Sequence 2:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster

Alignment Length:525 Identity:161/526 (31%)
Similarity:252/526 (48%) Gaps:77/526 (15%)


Mouse     8 LLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLLQMDRGGLLKSFIQLREKYG------DVF 66
            |||:|.|       |..|.: .|||||...|::|:.||:.         |||.:.|      |||
  Fly    13 LLAILFG-------GVRKPK-RFPPGPAWYPIVGSALQVS---------QLRCRLGMFCKVIDVF 60

Mouse    67 T-----------VHLGPRPVVMLCGTDTIREALVGQAEAFSGR--GTVAVVEPTFKEYGVIFANG 118
            .           :.:|...||:....|.|.|.:..  |...||  |....:.......||:..:|
  Fly    61 ARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDG 123

Mouse   119 ERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELR----KSQG--APLDPTFLFQCITAN 177
            |.|...|||.|..:::||..:..:.:.:..||.||:::|:    ||.|  ..::...|......|
  Fly   124 EMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLN 188

Mouse   178 IICSIVFGERFEYTDRQFLRLLELFYQTFSLIS------------SFSSQMFELFSGFLKYFPGA 230
            .:..::.|.|:|....:..:|||.|::.|..|.            .|.:..|..::||::    :
  Fly   189 TLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVE----S 249

Mouse   231 HRQISKNLQELLDYIGHSVEKHRATL-DPSVPRDFIDIYLLRMEKEKSNQHTEFHHQNLMMSVLS 294
            ||       .|..::...:|.||.|. :...|||.:|.| ||.:.|.:::...|..|:|:...|.
  Fly   250 HR-------SLYTFMSKEIELHRLTYKNYDEPRDLMDSY-LRAQDEGNDEKGMFSDQSLLAICLD 306

Mouse   295 LFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLD-DRTKMPYTDAVIHEIQR 358
            :|.||:||::.:|.:.|:.::..|.:.|:..:||.:|:|..|:|... ||||:||.:|:..|..|
  Fly   307 MFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVR 371

Mouse   359 FSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKS 423
            ...|...|:|||...||...||.:||:|.|.......|.:|..|..|:|||||.:| .:|.||..
  Fly   372 MFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLP 435

Mouse   424 EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSVAS--HVAPKDIDLTPKESGIGKIPPTYQI 486
            |||.||..|:..|:|:.:.|..||:|.|::||||.:.:  ...|:::   |.|.....:.| |.|
  Fly   436 EAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEV---PLEGATAAVKP-YDI 496

Mouse   487 CFLAR 491
            ..:||
  Fly   497 MLVAR 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp2b10NP_034129.1 p450 42..488 CDD:278495 145/487 (30%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 146/476 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111634075
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.