DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp26a1 and Cyp4d20

Sequence 1:NP_031837.2 Gene:Cyp26a1 MGIID:1096359 Length:497 Species:Mus musculus
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:512 Identity:114/513 (22%)
Similarity:200/513 (39%) Gaps:91/513 (18%)


Mouse    11 LCTFVLPLLLFLAALKLWDLYCVSSRDRSCALPLP----PGTMGFPFFGETLQMVLQRRK----F 67
            |.|..|.|||      .||.    .|.|...|...    ||.:..|..|..||.:....:    :
  Fly     5 LITGALILLL------TWDF----GRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGW 59

Mouse    68 LQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGAGCLSNLHDSS 132
            :..|..|||..::..:.|...:..........||.....|........:|..|..|.|.:.....
  Fly    60 VGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVSTGRKW 124

Mouse   133 HKQRKKVIMQAFSREALQCYVPVIAEEVSSCLEQWLSCGER----GLLVYPEVKRL--MFRIAMR 191
            | .|:|:...||..:.|:.||.::....|..::......:.    .:|.|..:..|  :...||.
  Fly   125 H-ARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMG 188

Mouse   192 ILLGCEPGPAGGGEDEQQLVEAFEEMT------------RNLFSLPIDVPFSGLYRGVKARNLIH 244
            :.:..:..|      :...::|.:.:.            |..:..|:..|            |:|
  Fly   189 VQVNAQNDP------DFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAP------------LLH 235

Mouse   245 ARIEENIRA--------------KIRRLQATEPDG------------GCKDALQLL--IEHSWER 281
            .::..:||.              .:||.:|   ||            |.|..:.||  :..|...
  Fly   236 RQLLSDIRVMHDFTDKVISERRETVRRAKA---DGTYRPLSLGDAEIGSKSQMALLDILLQSSIN 297

Mouse   282 GERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREEIKSKGLLCKSNQDNKLD 346
            .:.|....:::.....:|.|.:||:|..:..:..:..:|.|.|::.||::.   :...:....:.
  Fly   298 NQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQR---VLGPDASAPVT 359

Mouse   347 METLEQLKYTGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVADIFTNK 411
            ...|:.|||..||||||:||.||||...|.|.|..|:....||...::...:...|..|:.|.:.
  Fly   360 QAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDP 424

Mouse   412 EEFNPDRFIVPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLL 468
            ..|.|:||:....:..:.|:::||..|.::|:|::||.:.:|:...::.|.  ::||
  Fly   425 LSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRF--YELL 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp26a1NP_031837.2 p450 43..491 CDD:299894 103/481 (21%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 103/474 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.