DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp19a1 and Cyp4d20

Sequence 1:NP_001335100.1 Gene:Cyp19a1 MGIID:88587 Length:503 Species:Mus musculus
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:524 Identity:125/525 (24%)
Similarity:213/525 (41%) Gaps:129/525 (25%)


Mouse    26 MPLLLIMG--LLLLIWN---------CESSSSIPGPGYCLGIGPLISHG-RFLWMG----IGSAC 74
            |.|.||.|  :|||.|:         ....|:||||   :.| |::..| :.|.:|    ||...
  Fly     1 MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGP---ISI-PILGCGLQALHLGAENIIGWVG 61

Mouse    75 NYYNKMYGEFMRVWISGEETLIISKSSSMFHVMKHSHYISRFGSKRGLQCIGMHE-------NGI 132
            ..::| ||:..|.||.| |:||.:|....|..:..|..:...|.        ::|       :|:
  Fly    62 EKFDK-YGKTFRFWILG-ESLIYTKDLQYFETILSSTTLLEKGQ--------LYEYLRPFLNDGL 116

Mouse   133 IFNNNPSLWRTIRPFFMKALTGPGLVRMVEVCVESIKQH----LDRLGEVTDTSGYVDVLTLMRH 193
            :.:.... |...|..|..|..    .:::|..||.:.:|    :|.|.:|.|....||:|..:..
  Fly   117 LVSTGRK-WHARRKIFTHAFH----FKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSL 176

Mouse   194 IMLDTSNMLFLGIPLD-----ESAIVKKIQGYFNAWQALLIKPNIFFKIS----WLYRKYERSV- 248
            ..||......:|:.::     :...:|.::      ..:.|:|:..|:.|    ||:......: 
  Fly   177 AALDVITEAAMGVQVNAQNDPDFPYIKALK------SVVYIQPDRMFRFSRRYNWLFPLAAPLLH 235

Mouse   249 KDLKDEIAVLVEKKRHKVSTAEKLEDCMDFATDLIFAERR-----------------GD------ 290
            :.|..:|.|:     |            || ||.:.:|||                 ||      
  Fly   236 RQLLSDIRVM-----H------------DF-TDKVISERRETVRRAKADGTYRPLSLGDAEIGSK 282

Mouse   291 ------------------LTKENVNQCILEMLIAAPDTMSVTLYFMLLLVAEYPEVEAAILKEIH 337
                              |:..::.:.:...:....||.|..:...|..:|.:|||:..|.:|:.
  Fly   283 SQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQ 347

Mouse   338 TVVG---DRDIKIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIG 399
            .|:|   ...:....:|:||.::..|.|:||..|.|..:.|.|.::..|....:...|:|.|.:.
  Fly   348 RVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLY 412

Mouse   400 RMHR-LEYFPKPNEFTLENFEKNVPYRY----FQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRFQ 459
            ..|| ..|||.|..|..|.|.::....:    :.||..||:.|.|:..|::.|||::..:||.::
  Fly   413 YAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYE 477

Mouse   460 VKTL 463
            :..|
  Fly   478 LLPL 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp19a1NP_001335100.1 p450 48..488 CDD:306555 114/492 (23%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 114/492 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114623801
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.