DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp11a1 and Cyp12b2

Sequence 1:NP_062753.3 Gene:Cyp11a1 MGIID:88582 Length:526 Species:Mus musculus
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:494 Identity:138/495 (28%)
Similarity:224/495 (45%) Gaps:39/495 (8%)


Mouse    43 RSFNEIPSPGDNGWLNLYHFWRESG----TQKIHYHQMQSFQKYGPIY--REKLGTLESVYIVDP 101
            |||.|||.|   ..|.:..|:...|    |..|..:::.. :.||.||  ...:|...:|:..:|
  Fly    51 RSFGEIPGP---SLLRMLSFFMPGGALRNTNLIQMNRLMR-EMYGDIYCIPGMMGKPNAVFTYNP 111

Mouse   102 KDASILFSCEGPNPERFLVPPWVAYHQYYQRPI------GVLFKSSDAWKKDRIVLNQEVMAPGA 160
            .|..:.:..||..|.|..:.. :.|::...||.      |:.......|...|..:|..:|....
  Fly   112 DDFEMTYRNEGVWPIRIGLES-LNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQN 175

Mouse   161 IKNFVPLLEGVAQDFIKVLHRRIKQQNSGNFSGVISDDLFRFSFESISSVIFGERMGMLEEIVDP 225
            ::..:|.|:.::::||..|..: :...:...:....:.|..::|||||.|....|||:|.:..||
  Fly   176 VRQNLPQLDQISKEFIDKLETQ-RNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDP 239

Mouse   226 EAQRFINAVYQMFHTSVPMLNLPPDFFRLLRTKTWKDHAAAWDVIFNKADEYTQNFYWDLR--QK 288
            .|.|....:...|:.|. ..::.|..:...:|..:|.....:|.|.:....|.:.   .:|  .|
  Fly   240 NADRLAKHMRDFFNYSF-QFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIET---AMRGFGK 300

Mouse   289 RDFSQYPGVLYSLLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEVL 353
            .|..:...||..||..||   |.....:.:||..|:||||......||.:|.|...||.||.|:|
  Fly   301 NDDGKTKCVLEQLLEHNK---KVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELL 362

Mouse   354 AARRQAQGDMA-KMVQLVPLLKASIKETLRLHPISVTLQRYTVNDLVLRNYKIPAKTLVQVASFA 417
            ......:..:. :..:.:|.|:|.|||.||:..|:....|.|..||||..|::|..|.|.:....
  Fly   363 RILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLE 427

Mouse   418 MGRDPGFFPNPNKFDPTRWLEK-----------SQNTTHFRYLGFGWGVRQCLGRRIAELEMTIL 471
            :..|..:|...::|.|.|||:.           ::....|.||.||:|.|.|:|:||||||:..|
  Fly   428 LSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETL 492

Mouse   472 LINLLENFRIEVQNLRDVGTKFSLILMPENPILFNFQPL 510
            |:.||.::::.......:..:.::||.|...|.|..:|:
  Fly   493 LVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFKLEPV 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp11a1NP_062753.3 p450 49..507 CDD:278495 132/484 (27%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 126/465 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130939
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.