DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHE23 and net

DIOPT Version :9

Sequence 1:NP_542173.2 Gene:BHLHE23 / 128408 HGNCID:16093 Length:241 Species:Homo sapiens
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:218 Identity:48/218 - (22%)
Similarity:81/218 - (37%) Gaps:66/218 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     3 IRPPG-EPPSPGGAAMAELK----SLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPG 62
            :.||. :.|.|.....:.|:    .:...|::.:.|   .....|....|..||...        
  Fly   131 LTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHIYVRH---PGVTTLHRSLAAHPEQLE-------- 184

Human    63 GDLPAAPAPRAPAQAAESSGEQSGDEDDAF---------------EQRRRRRGPGSA-------- 104
                    |.|.....:...:|:|.:.:||               ::|.::....|:        
  Fly   185 --------PLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSD 241

Human   105 ADGRR-------RPREQ--------RSLRLSINARERRRMHDLNDALDGLRAVIP-YAHSPSVRK 153
            .|..:       ||.:.        |..|:..|||||.|:|.::.|.:.||..:| ||   |.:|
  Fly   242 EDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYA---STQK 303

Human   154 LSKIATLLLAKNYILMQAQALDE 176
            |||::.|.:|.:|||..::...|
  Fly   304 LSKLSVLRVACSYILTLSRMAGE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHE23NP_542173.2 bHLH_SF 111..191 CDD:412148 27/75 (36%)
netNP_001259789.1 HLH 269..320 CDD:278439 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.