Sequence 1: | NP_542173.2 | Gene: | BHLHE23 / 128408 | HGNCID: | 16093 | Length: | 241 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731223.1 | Gene: | ato / 40975 | FlyBaseID: | FBgn0010433 | Length: | 312 | Species: | Drosophila melanogaster |
Alignment Length: | 221 | Identity: | 59/221 - (26%) |
---|---|---|---|
Similarity: | 80/221 - (36%) | Gaps: | 77/221 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 5 PPGEPPS---PGGAAMAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLP 66
Human 67 AAPAPRAPAQAAESSGEQ-------------------------------SGDED----------- 89
Human 90 DAFEQRRRRRGPGSAADGRR-RPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRK 153
Human 154 LSKIATLLLAKNYILMQAQALDEMRR 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BHLHE23 | NP_542173.2 | bHLH_SF | 111..191 | CDD:412148 | 31/69 (45%) |
ato | NP_731223.1 | HLH | 253..312 | CDD:238036 | 29/64 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165145427 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |