DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHE23 and Oli

DIOPT Version :9

Sequence 1:NP_542173.2 Gene:BHLHE23 / 128408 HGNCID:16093 Length:241 Species:Homo sapiens
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:244 Identity:98/244 - (40%)
Similarity:123/244 - (50%) Gaps:58/244 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     5 PPGEPPSPGGAAMAELKSLS-GDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGG-DLPA 67
            |...||.........|.|:. |..|          |.|:  |.:::|....  ..|||.. :.|.
  Fly    35 PTASPPQSVPGRRTPLGSVGLGGFY----------AQGM--GMSQQPPTDE--NKPGPSAPEKPL 85

Human    68 APAPRAPAQAAESSGE-----QSGDEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERR 127
            :|...|.|..|.|.|.     .||...          |.||.: |:::.|:.:::||:|||||||
  Fly    86 SPTAAAIAAIAISGGTTTVAVSSGGAS----------GSGSNS-GKQKNRQGKTVRLNINARERR 139

Human   128 RMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAA 192
            ||||||||||.||:|||||||||||||||||||||||||||||..||:|:|||:|::....|   
  Fly   140 RMHDLNDALDELRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTTG--- 201

Human   193 PVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP 241
               ||||      .:..|.|.|.|              .||.:..|.:|
  Fly   202 ---AAPL------DLGAFPAAAKL--------------QALLQGPHNEP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHE23NP_542173.2 bHLH_SF 111..191 CDD:412148 59/79 (75%)
OliNP_001188830.1 HLH 134..188 CDD:197674 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617813at2759
OrthoFinder 1 1.000 - - FOG0002346
OrthoInspector 1 1.000 - - otm41513
orthoMCL 1 0.900 - - OOG6_106693
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5479
SonicParanoid 1 1.000 - - X1548
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.