DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHE23 and Hand

DIOPT Version :10

Sequence 1:NP_542173.2 Gene:BHLHE23 / 128408 HGNCID:16093 Length:241 Species:Homo sapiens
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:58 Identity:26/58 - (44%)
Similarity:32/58 - (55%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   118 RLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALD 175
            |.:.|.:||||...:|:|...||..||  :.|:..|||||.||.||..||......||
  Fly    60 RNTANKKERRRTQSINNAFSYLREKIP--NVPTDTKLSKIKTLKLAILYINYLVNVLD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHE23NP_542173.2 bHLH_SF 111..191 CDD:469605 26/58 (45%)
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 24/55 (44%)

Return to query results.
Submit another query.