powered by:
Protein Alignment BHLHE23 and ac
DIOPT Version :9
Sequence 1: | NP_542173.2 |
Gene: | BHLHE23 / 128408 |
HGNCID: | 16093 |
Length: | 241 |
Species: | Homo sapiens |
Sequence 2: | NP_476824.1 |
Gene: | ac / 30981 |
FlyBaseID: | FBgn0000022 |
Length: | 201 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 23/67 - (34%) |
Similarity: | 32/67 - (47%) |
Gaps: | 12/67 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 122 NARERRRMHDLNDALDGLRAVIPYAHSPSV------------RKLSKIATLLLAKNYILMQAQAL 174
|||||.|:..:|:....||..||.|....: :||||::||.:|..||....:.|
Fly 30 NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL 94
Human 175 DE 176
.|
Fly 95 HE 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
BHLHE23 | NP_542173.2 |
bHLH_SF |
111..191 |
CDD:412148 |
23/67 (34%) |
ac | NP_476824.1 |
HLH |
30..96 |
CDD:197674 |
22/65 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.