powered by:
Protein Alignment: CG43342 and GPD1
Sequence 1: | NP_001247238.1 |
Gene: | CG43342 |
FlyBaseID: | FBgn0263047 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010262.1 |
Gene: | GPD1 |
SGDID: | S000002180 |
Length: | 391 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 44 |
Identity: | 14/45 (31%) |
Similarity: | 21/45 (47%) |
Gaps: | 7/45 (16%) |
Fly 45 NVALQKRQLPYSRPT-----PQNRQELVESIEQDRKVLSAYFKR 83
|:|.:..|..:|..| |::.:. |..:.|.|||.|.|.|
Yeast 183 NIATEVAQEHWSETTVAYHIPKDFRG--EGKDVDHKVLKALFHR 224
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43342 | NP_001247238.1 |
BESS |
109..143 |
CDD:281011 |
|
GPD1 | NP_010262.1 |
glycerol3P_DH |
36..383 |
CDD:274551 |
14/45 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
|
0 |
Normalized mean entropy |
S475 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.