DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43342 and Gpdh2

DIOPT Version :9

Sequence 1:NP_001247238.1 Gene:CG43342 / 12798510 FlyBaseID:FBgn0263047 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611760.2 Gene:Gpdh2 / 37672 FlyBaseID:FBgn0034825 Length:358 Species:Drosophila melanogaster


Alignment Length:161 Identity:31/161 - (19%)
Similarity:51/161 - (31%) Gaps:58/161 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WNTS-------NVYDETTSENGDNEEQKASYIKEDHIETERKSLLLIKRNNVALQKRQLPYSRPT 59
            |.|:       ||.:..|.     :|:...|:.|:.:|..:.:.::   |...:..:.:|.....
  Fly    14 WATTIARNVGRNVLNSQTL-----DEKVPMYVYEEIVEGRKLTEII---NTTHINSKYMPNFELP 70

  Fly    60 PQNRQELVESIEQDRKVLSAYFKRLSSQRDEVTSPNAAPPAADSPVPQRNSYDLFFESACISVKG 124
            |.               :.|....:::.||......|.||.             |..|.|.::.|
  Fly    71 PN---------------IVAVDDIVTTARDADIIIFAIPPT-------------FVSSCCKTLLG 107

  Fly   125 LPPKLAAEAKS--------------RISQII 141
             ..|..|.|.|              .|||||
  Fly   108 -KVKPTAHAVSLIKGFERGDDGQFVLISQII 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43342NP_001247238.1 BESS 109..143 CDD:281011 13/47 (28%)
Gpdh2NP_611760.2 glycerol3P_DH 6..342 CDD:274551 31/161 (19%)
NAD_Gly3P_dh_N 6..174 CDD:279543 31/161 (19%)
NAD_Gly3P_dh_C 198..336 CDD:284817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S475
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.