powered by:
Protein Alignment: CG43342 and gpdh-1
Sequence 1: | NP_001247238.1 |
Gene: | CG43342 |
FlyBaseID: | FBgn0263047 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493454.1 |
Gene: | gpdh-1 |
WormBaseID: | WBGene00009824 |
Length: | 374 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 20/66 (30%) |
Similarity: | 30/66 (45%) |
Gaps: | 9/66 (14%) |
Fly 11 TTSENGDNEEQKASYIKEDHIETERKSLLLIKRNNVALQKRQLPYSRPTPQNRQELVESIEQDRK 75
||...|.|.:...::||.| |.|.:|::..:..|..|.| ||.|:..|::|..|...|
Worm 288 TTCYGGRNRKVAEAFIKSD------KPLRVIEQELLKGQSAQGP---PTAQDVYEMLEINEISEK 343
Fly 76 75
Worm 344 343
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
|
0 |
Normalized mean entropy |
S475 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.