DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43446 and ERG2

Sequence 1:NP_001247217.1 Gene:CG43446 FlyBaseID:FBgn0263400 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_013929.1 Gene:ERG2 SGDID:S000004815 Length:222 Species:Saccharomyces cerevisiae

Alignment Length:133 Identity:24/134 (18%)
Similarity:51/134 (38%) Gaps:26/134 (19%)


  Fly    18 DEHVRCWLCDEYAHAKCAG-------ITDSVVEMI---------EGRTGLKWTCETCRVVK-SQM 65
            ||::..::.:|:......|       :..||.|.:         ||.||:.:..:...::. :|:
Yeast    72 DEYINRYVKEEWVFNNAGGAMGQMIILHASVSEYLILFGTAVGTEGHTGVHFADDYFTILHGTQI 136

  Fly    66 GRFMKQTRTEI--TELFREVRAVYEKLAKLESHITSLDPQKPIYP-------VDSDSSSNPLHTF 121
            ......|..|:  ..:...::..|.|...:.....:|:..:...|       :|:.||:..|:|.
Yeast   137 AALPYATEAEVYTPGMTHHLKKGYAKQYSMPGGSFALELAQGWIPCMLPFGFLDTFSSTLDLYTL 201

  Fly   122 EDT 124
            ..|
Yeast   202 YRT 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43446NP_001247217.1 PHD_SF 3..58 CDD:304600 11/56 (20%)
ERG2NP_013929.1 ERG2_Sigma1R 23..216 CDD:309666 24/134 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004522
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.