DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43446 and sigmar1

Sequence 1:NP_001247217.1 Gene:CG43446 FlyBaseID:FBgn0263400 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001008207.1 Gene:sigmar1 XenbaseID:XB-GENE-5786075 Length:221 Species:Xenopus tropicalis

Alignment Length:73 Identity:19/74 (26%)
Similarity:33/74 (45%) Gaps:12/74 (16%)


  Fly    39 DSVVEMIEGRTGLKWTCETCRV------VKSQMGRFMKQT---RTEITELFREVRAVYEKLAKLE 94
            |::|..:...|.::|:..|..|      :.|.:|..:..|   ..:...||..|: ||.|...||
 Frog   147 DTIVHEVGEATSVQWSAGTWMVEYGRGFIPSTLGFALADTIFSTQDFLTLFYTVK-VYGKALLLE 210

  Fly    95 --SHITSL 100
              :|::.|
 Frog   211 TSTHLSEL 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43446NP_001247217.1 PHD_SF 3..58 CDD:304600 5/19 (26%)
sigmar1NP_001008207.1 ERG2_Sigma1R 21..210 CDD:309666 16/64 (25%)
Important for ligand-binding. {ECO:0000250|UniProtKB:Q60492} 96..103
C-terminal hydrophobic region. {ECO:0000305} 174..221 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004522
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.