Protein Alignment: CG43446 and Sigmar1

• Sequence 1: NP_001247217.1
• Gene: CG43446
• FlyBaseID: FBgn0263400
• Length: 267
• Species: Drosophila melanogaster
• Sequence 2: NP_112258.1
• Gene: Sigmar1
• RGDID: 68364
• Length: 223
• Species: Rattus norvegicus
• Alignment Length: 39
• Identity: 8/40 (20%)
• Similarity: 17/40 (43%)
• Gaps: 5/40 (13%)

  Fly   219 RKIASFKVMAPDPIYYTILNPGFWP-----KHIIVHEFV 252
            |::....|:..:.:.:..:|.|.|.     .|..:.|:|
  Rat    66 RRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYV 104

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG43446	NP_001247217.1	PHD_SF	3..58	CDD:304600
Sigmar1	NP_112258.1	Targeting to endoplasmic reticulum-associated lipid droplets. {ECO:0000250|UniProtKB:O55242}	2..8
		ERG2_Sigma1R	13..214	CDD:282477	8/40 (20%)
		Important for ligand-binding. {ECO:0000250|UniProtKB:Q60492}	99..106		2/7 (29%)
		C-terminal hydrophobic region. {ECO:0000305}	177..223

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000				FOG0004522
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000