DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43446 and W08F4.3

Sequence 1:NP_001247217.1 Gene:CG43446 FlyBaseID:FBgn0263400 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_493762.1 Gene:W08F4.3 WormBaseID:WBGene00021093 Length:228 Species:Caenorhabditis elegans

Alignment Length:74 Identity:25/75 (33%)
Similarity:35/75 (47%) Gaps:8/75 (11%)


  Fly    28 EYAHAKCAGITDSVVEMIEGRTGLKWTCETCRVVKSQMGRFMKQTRTEITELFREVRAVYEKLAK 92
            |:|.|..|....|      ||.||.|...||.|:|.::.||...|:.|.:|.|....|.  :..:
 Worm    96 EFAAAFSAPFPTS------GRPGLHWANTTCTVLKGKVSRFNDGTQDETSENFASGAAF--RHGQ 152

  Fly    93 LESHITSLD 101
            .|||:.|.:
 Worm   153 FESHVYSFE 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43446NP_001247217.1 PHD_SF 3..58 CDD:304600 11/30 (37%)
W08F4.3NP_493762.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004522
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.